Bos indicus (zebu cattle): 109554636 Help Entry 109554636         CDS       T04792                                  Symbol CFL1 Name (RefSeq) cofilin-1 isoform X1   KO K05765   cofilin Organism biu  Bos indicus (zebu cattle) Pathway biu04360   Axon guidance biu04666   Fc gamma R-mediated phagocytosis biu04810   Regulation of actin cytoskeleton biu05133   Pertussis biu05170   Human immunodeficiency virus 1 infection Brite KEGG Orthology (KO) [BR:biu00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     109554636 (CFL1)  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     109554636 (CFL1)   09158 Development and regeneration    04360 Axon guidance     109554636 (CFL1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     109554636 (CFL1)   09171 Infectious disease: bacterial    05133 Pertussis     109554636 (CFL1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:biu04131]     109554636 (CFL1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:biu04812]     109554636 (CFL1)    04147 Exosome [BR:biu04147]     109554636 (CFL1) Membrane trafficking [BR:biu04131]  Others   Actin-binding proteins    Others     109554636 (CFL1) Cytoskeleton proteins [BR:biu04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     ADF / Cofilin      109554636 (CFL1) Exosome [BR:biu04147]  Exosomal proteins   Proteins found in most exosomes    109554636 (CFL1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cofilin_ADF Motif Other DBs NCBI-GeneID:  109554636 NCBI-ProteinID:  XP_019810832 UniProt:  A0A6P5BDX2 LinkDB All DBs Position 29:complement(45983049..45985833) Genome browser AA seq 150 aa AA seqDB search MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDV GQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPECAPLKSKMIYASS KDAIKKKLTGKGQHWWXHMPLCLGLGCWVG NT seq 453 nt NT seq  +upstreamnt  +downstreamnt atggcctccggtgtggctgtctctgatggggtcatcaaagtgttcaacgacatgaaagtg cgtaagtcgtcgacaccagaggaagtgaagaagcgcaagaaggcggtgctcttctgcctg agtgaggacaagaagaatatcatcctggaggagggcaaggagatcctggtgggtgacgtg ggccagacggtagacgacccctatgccacctttgtcaagatgctgccagacaaggactgc cgctacgccctctatgatgcaacctacgagaccaaggagagcaagaaggaggacctggtg ttcatcttctgggcccctgagtgtgcaccccttaagagcaaaatgatctatgccagctcc aaggacgccatcaagaagaagctgacgggtaagggccagcattggtggcrccatatgccc ttgtgcttgggccttggctgctgggtggggtga

DBGET integrated database retrieval system