Bos indicus (zebu cattle): 109554797 Help Entry 109554797         CDS       T04792                                  Name (RefSeq) histone H2B type 2-E-like   KO K11252   histone H2B Organism biu  Bos indicus (zebu cattle) Pathway biu04613   Neutrophil extracellular trap formation biu05034   Alcoholism biu05203   Viral carcinogenesis biu05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:biu00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     109554797  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     109554797   09163 Immune disease    05322 Systemic lupus erythematosus     109554797   09165 Substance dependence    05034 Alcoholism     109554797  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:biu03036]     109554797   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:biu04147]     109554797 Chromosome and associated proteins [BR:biu03036]  Eukaryotic type   Nucleosome assembly factors    Histones     109554797 Exosome [BR:biu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    109554797 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa DUF6246 WASH-7_mid DUF6604 LonB_AAA-LID DUF3915 CENP-S CENP-T_C Motif Other DBs NCBI-GeneID:  109554797 NCBI-ProteinID:  XP_019810983 UniProt:  A0A6P5AW58 LinkDB All DBs Position X:21551309..21552887 Genome browser AA seq 140 aa AA seqDB search MPEPAKSAPAPKKGSKKAVTKAQKKDGEKRKHSRKESCSMYVYKVLKQVHLDTSISSKAM GIMNSFVNDIFECIAGEASCLAHYNKRSTITSRDIQTAVCLLLHRELAKHAVSEGTKAVT KFDVSTEDQRLVASDTYDAW NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atgcctgaaccggctaagtctgctcctgcccctaaaaagggctctaaaaaagctgtgacc aaggcccagaagaaggatggtgaaaagcgcaagcacagccgcaaggaaagctgctccatg tatgtgtacaaggtgctgaagcaagtccatctggacaccagcatctcgtccaaggccatg ggaattatgaactccttcgtcaaygacattttcgagtgcatcgctggtgaggcatcatgc ctggctcattacaacaagcgctcgactatcacatccagggatatccagaccgccgtgtgc ttgctgctacatagggagctggccaagcacgccgtgtctgagggcactaaagctgtcacc aaatttgatgtgtctactgaagaccagaggctggtggcaagtgacacctatgatgcttgg tga

DBGET integrated database retrieval system