Bos indicus (zebu cattle): 109555744 Help Entry 109555744         CDS       T04792                                  Name (RefSeq) histone H3   KO K11253   histone H3 Organism biu  Bos indicus (zebu cattle) Pathway biu04613   Neutrophil extracellular trap formation biu05034   Alcoholism biu05202   Transcriptional misregulation in cancer biu05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:biu00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     109555744  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     109555744   09163 Immune disease    05322 Systemic lupus erythematosus     109555744   09165 Substance dependence    05034 Alcoholism     109555744  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:biu03036]     109555744   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:biu04147]     109555744 Chromosome and associated proteins [BR:biu03036]  Eukaryotic type   Nucleosome assembly factors    Histones     109555744 Exosome [BR:biu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    109555744 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  109555744 NCBI-ProteinID:  XP_019812156 UniProt:  A0A6P5B5N9 LinkDB All DBs Position 3:complement(22281944..22282598) Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARESAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtacaaagcagactgcccgcaagtcgaccggtggcaaggccccgcggaagcag ctggccaccaaggcggctcgtgagagcgcgccggccacgggcggcgtcaagaagccgcat cgctaccggccgggtaccgtggccctgcgggagatccgacgctaccagaagtcgaccgag ctgctgatccgcaagctgccgttccagcggctggtgcgcgagatcgcgcaggacttcaag acggacctgcgcttccagagctcggccgtgatggcgctgcaggaggcgagcgaggcctac ctggtggggctgtttgaagacacgaacctgtgcgccatccacgccaagcgcgtgaccatc atgcccaaagacatccagctggctcgccgcatccgcggggagcgggcttaa

DBGET integrated database retrieval system