Bos indicus (zebu cattle): 109555800 Help Entry 109555800         CDS       T04792                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism biu  Bos indicus (zebu cattle) Pathway biu04613   Neutrophil extracellular trap formation biu05034   Alcoholism biu05203   Viral carcinogenesis biu05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:biu00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     109555800  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     109555800   09163 Immune disease    05322 Systemic lupus erythematosus     109555800   09165 Substance dependence    05034 Alcoholism     109555800  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:biu03036]     109555800 Chromosome and associated proteins [BR:biu03036]  Eukaryotic type   Nucleosome assembly factors    Histones     109555800 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  109555800 NCBI-ProteinID:  XP_019812192 UniProt:  A0A6P5DT92 A0A6P5BGQ9 LinkDB All DBs Position 3:complement(22365121..22365530) Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggaagaggaaaaggcggcaaaggcttaggcaagggtggtgccaagcgccaccgc aaagtcttgagagataacatccaaggcatcaccaagcccgccattcggcgccttgctcgg cgtgggggagtcaaacgcatttccggcctcatttacgaggagacccgaggcgtgttgaag gtgtttctggagaatgttattcgggacgcggtcacctacacagagcacgccaagcgcaag acggtcactgccatggacgtagtctacgcgctaaagcggcagggacgcaccctctacggc ttcggaggttga

DBGET integrated database retrieval system