Bos indicus (zebu cattle): 109555846 Help Entry 109555846         CDS       T04792                                  Name (RefSeq) histone H2A type 2-A-like   KO K11251   histone H2A Organism biu  Bos indicus (zebu cattle) Pathway biu03082   ATP-dependent chromatin remodeling biu04217   Necroptosis biu04613   Neutrophil extracellular trap formation biu05034   Alcoholism biu05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:biu00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     109555846  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     109555846  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     109555846  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     109555846   09165 Substance dependence    05034 Alcoholism     109555846  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:biu03036]     109555846   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:biu04147]     109555846 Chromosome and associated proteins [BR:biu03036]  Eukaryotic type   Nucleosome assembly factors    Histones     109555846 Exosome [BR:biu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    109555846 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  109555846 NCBI-ProteinID:  XP_019812250 UniProt:  A0A6P5BN62 LinkDB All DBs Position 3:24333717..24334235 Genome browser AA seq 130 aa AA seqDB search MSGRGKQGGKARAKAKSRSSRSGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAVVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK TESHHKAKGK NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atgtctggtcgtggcaagcaaggcggcaaggcccgcgccaaggccaagtcgcgctcgtct cgctcaggcttgcagttcccggtggggcgggtgcaccgcctgctgcgcaaaggcaactac gctgagcgggtgggggccggcgcgcccgtctacatggcggtggtcttggagtacctgacc gccgaaatcctggagctggcgggcaatgcggcgcgagacaacaagaagacgcgcatcatc cctcgtcacctgcagctggccatccgcaacgacgaggagctgaacaagctgttgggcaag gtcaccatcgcccagggcggcgttttgcccaatatccaggccgtgttgctcccgaagaag actgagagccaccacaaggcaaagggcaagtga

DBGET integrated database retrieval system