Bos indicus (zebu cattle): 109555963 Help Entry 109555963         CDS       T04792                                  Name (RefSeq) glutathione S-transferase Mu 1   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism biu  Bos indicus (zebu cattle) Pathway biu00480   Glutathione metabolism biu00980   Metabolism of xenobiotics by cytochrome P450 biu00982   Drug metabolism - cytochrome P450 biu00983   Drug metabolism - other enzymes biu01100   Metabolic pathways biu01524   Platinum drug resistance biu05200   Pathways in cancer biu05204   Chemical carcinogenesis - DNA adducts biu05207   Chemical carcinogenesis - receptor activation biu05208   Chemical carcinogenesis - reactive oxygen species biu05225   Hepatocellular carcinoma biu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:biu00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     109555963   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     109555963    00982 Drug metabolism - cytochrome P450     109555963    00983 Drug metabolism - other enzymes     109555963  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109555963    05204 Chemical carcinogenesis - DNA adducts     109555963    05207 Chemical carcinogenesis - receptor activation     109555963    05208 Chemical carcinogenesis - reactive oxygen species     109555963   09162 Cancer: specific types    05225 Hepatocellular carcinoma     109555963   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     109555963   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     109555963  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:biu02000]     109555963 Enzymes [BR:biu01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      109555963 Transporters [BR:biu02000]  Other transporters   Pores ion channels [TC:1]    109555963 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  GST_N GST_C GST_C_3 GST_C_6 GST_N_3 GST_N_2 GST_C_2 GST_C_7 Motif Other DBs NCBI-GeneID:  109555963 NCBI-ProteinID:  XP_019812446 UniProt:  A0A6P5B6G3 LinkDB All DBs Position 3:complement(36372224..36383204) Genome browser AA seq 218 aa AA seqDB search MPMILGYWDIRGLAHAIRLLLEYTDTNYEERQYSVGDAPDYDRSQWLNEKFKLGLDFPNL PYLIDGTHKLTQSNAILRYIARKHNLCGETEEEMIRVDILENQVMDVRLAMARICYSPDF EKLKPGFLKEIPEKIKLFSEFLGKRPWFAGDKLTYVDFLVYDVLDMHRIFEPKCLDAFPN LKDFISRFEGLKKISAYMKSSRFLPGPLFMKLAVWGNK NT seq 657 nt NT seq  +upstreamnt  +downstreamnt atgcccatgatcctgggttactgggacatccgcgggctggcccatgccatccgccttctc ctggagtacacagacacaaactatgaggagaggcagtactcggtaggagatgctcccgac tatgacagaagccagtggctgaatgaaaaattcaagctgggcctggacttccccaatctg ccctacttaatcgatgggactcacaagctcacccagagcaacgccatccttcggtacatc gctcgcaagcacaacctgtgtggggagacagaggaggagatgattcgtgtggacattttg gagaaccaggttatggatgtccgcttggccatggccaggatctgctacagccctgacttt gagaaactgaagcctggtttcttgaaggagatccctgaaaaaatcaagctgttctcagag tttctggggaagaggccttggtttgcaggggacaagctcacctatgtggatttcctggtt tatgacgtccttgacatgcaccgcatatttgagcccaagtgcctggacgcattcccaaac ctgaaagacttcatttctcgttttgagggcctgaagaagatctctgcctacatgaagtcc agccgcttcctcccaggccctctgttcatgaagcttgccgtgtggggcaacaagtag

DBGET integrated database retrieval system