Bos indicus (zebu cattle): 109556178 Help Entry 109556178         CDS       T04792                                  Symbol SOD1 Name (RefSeq) superoxide dismutase [Cu-Zn]   KO K04565   superoxide dismutase, Cu-Zn family [EC:1.15.1.1] Organism biu  Bos indicus (zebu cattle) Pathway biu04146   Peroxisome biu04213   Longevity regulating pathway - multiple species biu05012   Parkinson disease biu05014   Amyotrophic lateral sclerosis biu05016   Huntington disease biu05020   Prion disease biu05022   Pathways of neurodegeneration - multiple diseases biu05208   Chemical carcinogenesis - reactive oxygen species Brite KEGG Orthology (KO) [BR:biu00001]  09140 Cellular Processes   09141 Transport and catabolism    04146 Peroxisome     109556178 (SOD1)  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     109556178 (SOD1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     109556178 (SOD1)   09164 Neurodegenerative disease    05012 Parkinson disease     109556178 (SOD1)    05014 Amyotrophic lateral sclerosis     109556178 (SOD1)    05016 Huntington disease     109556178 (SOD1)    05020 Prion disease     109556178 (SOD1)    05022 Pathways of neurodegeneration - multiple diseases     109556178 (SOD1) Enzymes [BR:biu01000]  1. Oxidoreductases   1.15  Acting on superoxide as acceptor    1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)     1.15.1.1  superoxide dismutase      109556178 (SOD1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Sod_Cu Motif Other DBs NCBI-GeneID:  109556178 NCBI-ProteinID:  XP_019812889 UniProt:  A0A6P5BP41 LinkDB All DBs Position 1:complement(2935097..2943696) Genome browser AA seq 152 aa AA seqDB search MATKAVCVLKGDGPVQGTIHFEAKGDTVVVTGSITGLTEGDHGFHVHQFGDNTQGCTSAG PHFNPLSKKHGGPKDEERHVGDLGNVTADKNGVAFVDIVDPLISLSGEYSIIGRTMVVHE KPDDLGRGGNEESTKTGNAGSRLACGVIGIAK NT seq 459 nt NT seq  +upstreamnt  +downstreamnt atggcgacgaaggccgtctgcgtgctgaagggcgacggcccggtgcaaggcaccatccac ttcgaggcaaagggagatacagtcgtggtaactggatccattacaggattgactgaaggt gatcatggattccacgtccatcagtttggagacaatacacaaggctgtaccagtgcaggt cctcactttaatcctctgtccaaaaaacacggtgggccaaaagatgaagagaggcatgtt ggagacctgggcaatgtgacagctgacaaaaacggtgttgccttcgtggatattgtagat cctctgatttcactctcaggagaatattccatcattggccgcacgatggtggtccatgaa aaaccagatgacttgggcagaggtggaaatgaagaaagtacaaagactggaaacgctgga agtcgtttggcctgtggtgtaattggaattgccaagtaa

DBGET integrated database retrieval system