Bos indicus (zebu cattle): 109557292 Help Entry 109557292         CDS       T04792                                  Name (RefSeq) histone H3.3-like   KO K11253   histone H3 Organism biu  Bos indicus (zebu cattle) Pathway biu04613   Neutrophil extracellular trap formation biu05034   Alcoholism biu05202   Transcriptional misregulation in cancer biu05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:biu00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     109557292  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     109557292   09163 Immune disease    05322 Systemic lupus erythematosus     109557292   09165 Substance dependence    05034 Alcoholism     109557292  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:biu03036]     109557292   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:biu04147]     109557292 Chromosome and associated proteins [BR:biu03036]  Eukaryotic type   Nucleosome assembly factors    Histones     109557292 Exosome [BR:biu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    109557292 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone PAF CENP-T_C Zn_ribbon_RPAB4 CENP-S Phage_GP58 Motif Other DBs NCBI-GeneID:  109557292 NCBI-ProteinID:  XP_019814084 UniProt:  A0A6P5BQG2 LinkDB All DBs Position 4:31275774..31276237 Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTSGKAPRKQLATKAARKSAPSTGRVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQSLVREIAQDFKTDLRFQSAAIGALLEASEAYLVGLFEDTNLCAICAKRVTI MPKDIQLACRKCGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtacaaagcagactgcccgcaaatcgaccagtggtaargcaccgaggaagcaa ctcgctacaaaagccgctcgcaagagtgcgccctctactggacgggtgaagaaacctcat cgttacaggcctggtactgtggcactccgtgaaattagacgttatcagaagtccactgaa cttctgattcgcaaacttcccttccagagtctggtgcgggaaattgctcaggacttcaaa acagatctgcgcttccagagtgcagctattggtgctttgctggaggcaagtgaggcctac ctggttggcctttttgaagacaccaacctgtgtgctatctgtgccaaacgtgtaacaatt atgccaaaagacattcagctagcatgccgcaaatgtggagaacgtgcttaa

DBGET integrated database retrieval system