Bos indicus (zebu cattle): 109558865 Help Entry 109558865         CDS       T04792                                  Name (RefSeq) histone H2B type 2-E-like   KO K11252   histone H2B Organism biu  Bos indicus (zebu cattle) Pathway biu04613   Neutrophil extracellular trap formation biu05034   Alcoholism biu05203   Viral carcinogenesis biu05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:biu00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     109558865  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     109558865   09163 Immune disease    05322 Systemic lupus erythematosus     109558865   09165 Substance dependence    05034 Alcoholism     109558865  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:biu03036]     109558865   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:biu04147]     109558865 Chromosome and associated proteins [BR:biu03036]  Eukaryotic type   Nucleosome assembly factors    Histones     109558865 Exosome [BR:biu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    109558865 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa DUF6246 Motif Other DBs NCBI-GeneID:  109558865 NCBI-ProteinID:  XP_019815735 UniProt:  A0A6P5BSC5 LinkDB All DBs Position 5:25046591..25046971 Genome browser AA seq 126 aa AA seqDB search MPELAKSAPAPRKGSKKAVTKAQNKDGKKRKRNCKESYSVYVYKVLKQVHPDTSISSKAM GIMNSFVNDIFERIAGEAWRLAHYNKRSTITSREIHTAVHLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgaactggctaagtctgctcctgcccctagaaagggctctaaaaaagctgtgacc aaggcccagaataaggatggcaagaagcgcaagcgcaactgcaaggagagctactccgtg tatgtgtacaaggtgctgaagcaagtccatccggacaccagcatctcgtccaaggccatg ggaatcatgaactccttcgtcaacgacattttcgagcgcatcgctggcgaggcgtggcgc ctggcgcattacaacaagcgctcaactatcacatccagggagatccatacggccgtgcac ttgctgctacctggggagctggccaagcacgccgtgtccgagggcactaaggctgtcacc aagtataccagctccaagtaa

DBGET integrated database retrieval system