Bos indicus (zebu cattle): 109559113 Help Entry 109559113         CDS       T04792                                  Name (RefSeq) histone H4-like   KO K11254   histone H4 Organism biu  Bos indicus (zebu cattle) Pathway biu04613   Neutrophil extracellular trap formation biu05034   Alcoholism biu05203   Viral carcinogenesis biu05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:biu00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     109559113  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     109559113   09163 Immune disease    05322 Systemic lupus erythematosus     109559113   09165 Substance dependence    05034 Alcoholism     109559113  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:biu03036]     109559113 Chromosome and associated proteins [BR:biu03036]  Eukaryotic type   Nucleosome assembly factors    Histones     109559113 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CBFD_NFYB_HMF CENP-S TFIID-31kDa Bromo_TP TAFII28 TFIID_20kDa UPF0137 Motif Other DBs NCBI-GeneID:  109559113 NCBI-ProteinID:  XP_019816143 UniProt:  A0A6P5BDC2 LinkDB All DBs Position 5:32278282..32278593 Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHSKVLRDNIQGATKPAIRRLARRGGVKRISGLIYEEMCGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggtcgtggcaagggcggtaagggcctcgggaaagggggtgctaagcgccacagc aaggttcttcgtgacaacatccagggcgccaccaagcccgccattcgtcgtctggctcgt cgtggtggcgtgaagcggatctccggtctcatctatgaggagatgtgcggggtgctgaag gtgttcctggaaaatgtgattcgggacgcggtcacatacaccgagcacgccaagcgcaaa actgttactgccatggatgtggtgtacgcgctcaagcgccagggacgtaccctttacggc ttcggcggttaa

DBGET integrated database retrieval system