Bos indicus (zebu cattle): 109559602 Help Entry 109559602         CDS       T04792                                  Symbol IAPP Name (RefSeq) islet amyloid polypeptide   KO K08039   islet amyloid polypeptide Organism biu  Bos indicus (zebu cattle) Pathway biu04080   Neuroactive ligand-receptor interaction biu04950   Maturity onset diabetes of the young Brite KEGG Orthology (KO) [BR:biu00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     109559602 (IAPP)  09160 Human Diseases   09167 Endocrine and metabolic disease    04950 Maturity onset diabetes of the young     109559602 (IAPP)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:biu04052]     109559602 (IAPP) Cytokines and neuropeptides [BR:biu04052]  Neuropeptides   Neuropeptides (GPCR binding)    109559602 (IAPP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Calc_CGRP_IAPP Motif Other DBs NCBI-GeneID:  109559602 NCBI-ProteinID:  XP_019817037 UniProt:  A0A6P5BV48 LinkDB All DBs Position 5:complement(95014763..95020313) Genome browser AA seq 91 aa AA seqDB search MGILKLPVVLIVLCVALNHLEGGGKPTESHQMEKRKCGTATCETQRLANFLAPSSNKLGA IFSPTKMGSNTYGKRKKVEILKREPLSYLPI NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgggtattttgaagctgccggtggttctcattgtgctctgtgttgcgttaaaccatctg gaaggtggtggtaaacccactgaaagtcatcagatggaaaagcggaaatgcggcactgcc acttgtgagactcaacgcctggcaaattttttagctccatccagcaacaaacttggcgcc attttctcacctacgaagatgggatccaatacatatggcaagaggaaaaaagttgagatt ttaaagagagaaccattgagttacttgcccatttag

DBGET integrated database retrieval system