Bos indicus (zebu cattle): 109560439 Help Entry 109560439         CDS       T04792                                  Name (RefSeq) histone H4-like   KO K11254   histone H4 Organism biu  Bos indicus (zebu cattle) Pathway biu04613   Neutrophil extracellular trap formation biu05034   Alcoholism biu05203   Viral carcinogenesis biu05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:biu00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     109560439  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     109560439   09163 Immune disease    05322 Systemic lupus erythematosus     109560439   09165 Substance dependence    05034 Alcoholism     109560439  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:biu03036]     109560439 Chromosome and associated proteins [BR:biu03036]  Eukaryotic type   Nucleosome assembly factors    Histones     109560439 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  109560439 NCBI-ProteinID:  XP_019818248 UniProt:  A0A6P5BY58 LinkDB All DBs Position 6:complement(67890185..67890502) Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVXRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggaagaggaaaaggcggcaaaggcttaggcaagggtggtgctaagcgccaccgc aaagtcttgagagataacatccaaggcatcaccaagcccgccattcggcgccttgctcgg cgtgggggagtcamacgcatttccggcctcatttacgaggagacccgaggcgtgttgaag gtgtttctggagaatgttattcgggacgcggtcacctacacagagcacgccaagcgcaag acggtcactgccatggacgtggtctacgcgctaaagcggcagggacgcactctctacggc ttcggaggttga

DBGET integrated database retrieval system