Bos indicus (zebu cattle): 109561305 Help Entry 109561305         CDS       T04792                                  Symbol IL12B Name (RefSeq) interleukin-12 subunit beta   KO K05425   interleukin 12B Organism biu  Bos indicus (zebu cattle) Pathway biu04060   Cytokine-cytokine receptor interaction biu04620   Toll-like receptor signaling pathway biu04622   RIG-I-like receptor signaling pathway biu04625   C-type lectin receptor signaling pathway biu04630   JAK-STAT signaling pathway biu04658   Th1 and Th2 cell differentiation biu04936   Alcoholic liver disease biu04940   Type I diabetes mellitus biu05133   Pertussis biu05134   Legionellosis biu05140   Leishmaniasis biu05142   Chagas disease biu05143   African trypanosomiasis biu05145   Toxoplasmosis biu05146   Amoebiasis biu05152   Tuberculosis biu05162   Measles biu05164   Influenza A biu05168   Herpes simplex virus 1 infection biu05171   Coronavirus disease - COVID-19 biu05200   Pathways in cancer biu05205   Proteoglycans in cancer biu05321   Inflammatory bowel disease biu05330   Allograft rejection biu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:biu00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     109561305 (IL12B)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     109561305 (IL12B)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     109561305 (IL12B)    04622 RIG-I-like receptor signaling pathway     109561305 (IL12B)    04625 C-type lectin receptor signaling pathway     109561305 (IL12B)    04658 Th1 and Th2 cell differentiation     109561305 (IL12B)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109561305 (IL12B)    05205 Proteoglycans in cancer     109561305 (IL12B)   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     109561305 (IL12B)    05164 Influenza A     109561305 (IL12B)    05162 Measles     109561305 (IL12B)    05168 Herpes simplex virus 1 infection     109561305 (IL12B)   09171 Infectious disease: bacterial    05133 Pertussis     109561305 (IL12B)    05134 Legionellosis     109561305 (IL12B)    05152 Tuberculosis     109561305 (IL12B)   09174 Infectious disease: parasitic    05146 Amoebiasis     109561305 (IL12B)    05145 Toxoplasmosis     109561305 (IL12B)    05140 Leishmaniasis     109561305 (IL12B)    05142 Chagas disease     109561305 (IL12B)    05143 African trypanosomiasis     109561305 (IL12B)   09163 Immune disease    05321 Inflammatory bowel disease     109561305 (IL12B)    05330 Allograft rejection     109561305 (IL12B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     109561305 (IL12B)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     109561305 (IL12B)    04936 Alcoholic liver disease     109561305 (IL12B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:biu04052]     109561305 (IL12B)    00536 Glycosaminoglycan binding proteins [BR:biu00536]     109561305 (IL12B) Cytokines and neuropeptides [BR:biu04052]  Cytokines   Interleukins    109561305 (IL12B) Glycosaminoglycan binding proteins [BR:biu00536]  Heparan sulfate / Heparin   Cytokines    109561305 (IL12B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL12p40_C Ig_5 Ig_3 Ig_4 Ig_2 fn3 I-set ig Motif Other DBs NCBI-GeneID:  109561305 NCBI-ProteinID:  XP_019819240 UniProt:  A0A6P5C192 LinkDB All DBs Position 7:complement(70582567..70593137) Genome browser AA seq 327 aa AA seqDB search MHPQQLVVSWFSLVLLASPIVAMWELEKNVYVVELDWYPDAPGETVVLTCDTPEEDGITW TSDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEALSRSLLLLHKKEDGIWSTDILKDQ KEPKAKSFLKCEAKDYSGHFTCWWLTAISTDLKFSVKSSRGSSDPRGVTCGAAXLSAEKV SLEHREYNKYTVECQEGSACPAAEESLLIEVVVEAVHKLKYENYTSSFFIRDIIKPDPPK NLQLRPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKNKREKKLFMDQTSAKVTCH KDANVRVQARDRYYSSFWSEWASVSCS NT seq 984 nt NT seq  +upstreamnt  +downstreamnt atgcaccctcagcagttggtcgtttcctggttttccctggttttgctggcatctcccatc gtggccatgtgggaactggagaaaaatgtttatgttgtagaattggattggtatcctgat gctcctggagaaacagtggtcctcacatgtgacactcctgaagaagatggcatcacctgg acctcagaccagagcagtgaggtcttgggctctggcaaaaccttgaccatccaagtcaaa gagtttggagatgctgggcagtacacctgtcacaaaggaggcgaggctctgagtcgttca ctcctcctgctgcacaaaaaggaagatggaatttggtccactgatattttaaaggatcag aaagaacccaaagctaagagttttttaaaatgtgaggcaaaggattattctggacacttc acctgctggtggctgacagcaatcagtactgatttgaaattcagtgtcaaaagcagcaga ggctcctctgacccccgaggggtgacgtgcggagcagcgtygctctcagcagagaaggtc agcttggagcacagggagtataacaagtacacagtggagtgtcaggagggcagcgcctgc ccagccgcygaggagagcctgcttattgaggtcgtggtagaagctgtgcacaagctcaag tatgaaaactacaccagcagcttcttcatcagggacatcatcaaaccagacccacccaag aacctgcaactgagaccattaaagaattctcggcaggtggaggtcagctgggagtaccct gacacgtggagcaccccgcattcctacttctccctgacgttttgtgttcaggtccaggga aagaacaagagagaaaagaaactcttcatggaccaaacctcagccaaagtcacatgccac aaggatgccaacgtccgcgtgcaagcccgggaccgctactacagctcattctggagtgaa tgggcatctgtgtcctgcagttag

DBGET integrated database retrieval system