Bos indicus (zebu cattle): 109561892 Help Entry 109561892         CDS       T04792                                  Symbol RAB5A Name (RefSeq) ras-related protein Rab-5A   KO K07887   Ras-related protein Rab-5A Organism biu  Bos indicus (zebu cattle) Pathway biu04014   Ras signaling pathway biu04137   Mitophagy - animal biu04144   Endocytosis biu04145   Phagosome biu04148   Efferocytosis biu04962   Vasopressin-regulated water reabsorption biu05014   Amyotrophic lateral sclerosis biu05022   Pathways of neurodegeneration - multiple diseases biu05132   Salmonella infection biu05146   Amoebiasis biu05152   Tuberculosis Brite KEGG Orthology (KO) [BR:biu00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     109561892 (RAB5A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     109561892 (RAB5A)    04145 Phagosome     109561892 (RAB5A)    04137 Mitophagy - animal     109561892 (RAB5A)    04148 Efferocytosis     109561892 (RAB5A)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     109561892 (RAB5A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     109561892 (RAB5A)    05152 Tuberculosis     109561892 (RAB5A)   09174 Infectious disease: parasitic    05146 Amoebiasis     109561892 (RAB5A)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     109561892 (RAB5A)    05022 Pathways of neurodegeneration - multiple diseases     109561892 (RAB5A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:biu04131]     109561892 (RAB5A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:biu04147]     109561892 (RAB5A)    04031 GTP-binding proteins [BR:biu04031]     109561892 (RAB5A) Membrane trafficking [BR:biu04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     109561892 (RAB5A)  Endosome - Lysosome transport     109561892 (RAB5A) Exosome [BR:biu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    109561892 (RAB5A)   Exosomal proteins of other body fluids (saliva and urine)    109561892 (RAB5A)   Exosomal proteins of colorectal cancer cells    109561892 (RAB5A)   Exosomal proteins of bladder cancer cells    109561892 (RAB5A) GTP-binding proteins [BR:biu04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     109561892 (RAB5A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 RsgA_GTPase AAA_16 MCR_beta BrnT_toxin Motif Other DBs NCBI-GeneID:  109561892 NCBI-ProteinID:  XP_019820258 UniProt:  A0A6P5C3Y6 LinkDB All DBs Position 1:160720718..160753950 Genome browser AA seq 215 aa AA seqDB search MANRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQ TVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQR QASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKK LPKNEPQNPGANSTRGRGVDLTEPTQPTRSQCCSN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atggctaatcgaggagcaacaagacccaacgggccaaatactggaaataaaatatgccag ttcaaactagtacttctgggagagtctgctgttggcaaatcaagccttgtgcttcgtttt gtgaagggccagtttcatgaatttcaagagagtaccattggggctgcttttctaactcaa acggtatgtcttgatgacacgacagtaaaatttgaaatatgggatacggctggccaagag cggtaccacagcctggcgcccatgtactacagaggcgcccaggccgccatagtcgtgtac gacatcacgaacgaggagtcctttgccagagccaaaaactgggttaaagagcttcagagg caagccagtcctaacattgtaatagctttatcaggaaacaaggccgatctggcaaataaa agagctgtcgactttcaggaggcacagtcctatgcggatgataacagtttattatttatg gagacatcagctaaaacatcaatgaatgtaaatgaaatattcatggcaatagctaaaaag ttgccaaagaatgaaccacagaatccaggagcaaattctaccagaggaagaggagtagac ctcaccgagcccacacagcccaccaggagtcagtgctgtagtaactaa

DBGET integrated database retrieval system