Bos indicus (zebu cattle): 109561903 Help Entry 109561903         CDS       T04792                                  Symbol PFN3 Name (RefSeq) LOW QUALITY PROTEIN: profilin-3   KO K05759   profilin Organism biu  Bos indicus (zebu cattle) Pathway biu04015   Rap1 signaling pathway biu04810   Regulation of actin cytoskeleton biu05014   Amyotrophic lateral sclerosis biu05132   Salmonella infection Brite KEGG Orthology (KO) [BR:biu00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     109561903 (PFN3)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     109561903 (PFN3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     109561903 (PFN3)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     109561903 (PFN3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:biu04131]     109561903 (PFN3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:biu04812]     109561903 (PFN3)    04147 Exosome [BR:biu04147]     109561903 (PFN3) Membrane trafficking [BR:biu04131]  Others   Actin-binding proteins    Others     109561903 (PFN3) Cytoskeleton proteins [BR:biu04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      109561903 (PFN3) Exosome [BR:biu04147]  Exosomal proteins   Proteins found in most exosomes    109561903 (PFN3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Terminase-T7_RNaseH-like Motif Other DBs NCBI-GeneID:  109561903 NCBI-ProteinID:  XP_019820269 UniProt:  A0A6P5C3U2 LinkDB All DBs Position 7:complement(38238609..38239069) Genome browser AA seq 137 aa AA seqDB search MGDWKGYISAVLRDQRIDDVAIVGHSDNRCVWASRPGGLLAAISPQEVGVLTGPDRSTXL QAGLCVAGRRCCVIRDHLLAEGDGVLDARTKGLDGRAICVGHTPRALLVLMGRRGVHGGI LNKTMHELIHGLRSQGT NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgggcgactggaaaggttacatcagtgcagtgcttcgggaccagcgcatcgacgacgtg gccattgtgggccactcggacaatcgctgcgtgtgggcctcgaggcctgggggcctgctg gcggccatctcaccgcaggaggtgggtgtgctcaccgggccagaccggagcactnntctg caggccgggctgtgcgtggcgggccgccgttgctgcgtcatccgagaccacctgctggcg gagggtgacggagtgctggatgcacgcaccaagggtctggacgggcgcgccatctgcgtg ggccacacgcctcgggcgcttctcgtgctcatgggccggcggggtgtgcatgggggcatt ctcaacaagacgatgcacgagctgatccatgggctgcgctcacagggcacctag

DBGET integrated database retrieval system