Bos indicus (zebu cattle): 109562575 Help Entry 109562575         CDS       T04792                                  Name (RefSeq) cystatin-B-like   KO K13907   cystatin-A/B Organism biu  Bos indicus (zebu cattle) Brite KEGG Orthology (KO) [BR:biu00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:biu01002]     109562575   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:biu04147]     109562575 Peptidases and inhibitors [BR:biu01002]  Peptidase inhibitors   Family I25: cystatin family    109562575 Exosome [BR:biu04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    109562575 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cystatin Motif Other DBs NCBI-GeneID:  109562575 NCBI-ProteinID:  XP_019821170 UniProt:  A0A6P5C6G6 LinkDB All DBs Position 8:89436710..89437003 Genome browser AA seq 97 aa AA seqDB search MMCGAPPTKQLATAEIQAIADKVKSPLXEKENKKFPVFNAVEFKSQGVAGRTFFIKVQMD DDFVHIQVLESLPQENKPVALTSYQIHKGRHDEVTCF NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgatgtgtggtgcaccccccaccaagcagctggccacggctgagatccaggccattgct gacaaagtgaagtctccgctgraagagaaggaaaacaagaagttcccggtgttcaatgct gtggagttcaaaagccaaggggttgctgggaggaccttcttcatcaaggttcaaatggat gatgacttcgtgcacattcaagtgttggaaagccttccacaggagaacaagccagtggcc ttgaccagctaccagatccacaaaggcagacacgacgaagtgacgtgcttctag

DBGET integrated database retrieval system