Bos indicus (zebu cattle): 109562638 Help Entry 109562638         CDS       T04792                                  Name (RefSeq) interferon alpha-G-like   KO K05414   interferon alpha Organism biu  Bos indicus (zebu cattle) Pathway biu04060   Cytokine-cytokine receptor interaction biu04151   PI3K-Akt signaling pathway biu04217   Necroptosis biu04620   Toll-like receptor signaling pathway biu04621   NOD-like receptor signaling pathway biu04622   RIG-I-like receptor signaling pathway biu04623   Cytosolic DNA-sensing pathway biu04630   JAK-STAT signaling pathway biu04650   Natural killer cell mediated cytotoxicity biu04936   Alcoholic liver disease biu05152   Tuberculosis biu05160   Hepatitis C biu05161   Hepatitis B biu05162   Measles biu05163   Human cytomegalovirus infection biu05164   Influenza A biu05165   Human papillomavirus infection biu05167   Kaposi sarcoma-associated herpesvirus infection biu05168   Herpes simplex virus 1 infection biu05169   Epstein-Barr virus infection biu05170   Human immunodeficiency virus 1 infection biu05171   Coronavirus disease - COVID-19 biu05200   Pathways in cancer biu05320   Autoimmune thyroid disease biu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:biu00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     109562638    04151 PI3K-Akt signaling pathway     109562638   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     109562638  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     109562638  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     109562638    04621 NOD-like receptor signaling pathway     109562638    04622 RIG-I-like receptor signaling pathway     109562638    04623 Cytosolic DNA-sensing pathway     109562638    04650 Natural killer cell mediated cytotoxicity     109562638  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109562638   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     109562638    05161 Hepatitis B     109562638    05160 Hepatitis C     109562638    05171 Coronavirus disease - COVID-19     109562638    05164 Influenza A     109562638    05162 Measles     109562638    05168 Herpes simplex virus 1 infection     109562638    05163 Human cytomegalovirus infection     109562638    05167 Kaposi sarcoma-associated herpesvirus infection     109562638    05169 Epstein-Barr virus infection     109562638    05165 Human papillomavirus infection     109562638   09171 Infectious disease: bacterial    05152 Tuberculosis     109562638   09163 Immune disease    05320 Autoimmune thyroid disease     109562638   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     109562638   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     109562638  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:biu04052]     109562638 Cytokines and neuropeptides [BR:biu04052]  Cytokines   Interferons    109562638 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon pAdhesive_17 Motif Other DBs NCBI-GeneID:  109562638 NCBI-ProteinID:  XP_019821226 UniProt:  A0A6P5C6H6 LinkDB All DBs Position 8:complement(23898000..23898682) Genome browser AA seq 189 aa AA seqDB search MAPAWSFLLALLLLSCNAICSLGCHLPHTHSLANRRVLMLLQQLRRVSPSSCLQDRNDFA FPQEALGGSQLQKAQAISVLHEVTQHTFQLFSTEGSAITWDESLLDKLRTALDQQLTDLQ FCLRQEXGLRGAPLLKEDSSLAVRKYFHRLTLYLQEKRHSPCAWEVVRAEVMRAFSSSTN LQERFRRKD NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccccagcctggtccttcctcctggccctgctgctgctcagctgcaacgccatctgc tctctgggctgccacctgcctcacacccacagcctggccaacaggagggtcctgatgctc ctgcaacaactgaggagggtctccccttcttcctgcctgcaggacagaaatgacttcgca ttcccccaggaggcgctgggtggcagccagttgcagaaggctcaagccatctctgtgctc cacgaggtgacccagcacaccttccagctcttcagcacagarggctcggccatcacgtgg gacgagagcctcctggacaagctccgcactgcactggatcagcagctcactgacctgcaa ttctgtctgaggcaggaggmggggctgcgaggggctcccctgctcaaggaggactccagc ctggctgtgaggaaatatttccacagactcactctctatctgcaagagaagagacacagc ccttgtgcctgggaggttgtcagagcagaagtcatgagagccttctcttcctcaacaaac ttgcaggagagattcaggagaaaggactga

DBGET integrated database retrieval system