Bos indicus (zebu cattle): 109563306 Help Entry 109563306         CDS       T04792                                  Symbol PPP3R2 Name (RefSeq) calcineurin subunit B type 2   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism biu  Bos indicus (zebu cattle) Pathway biu04010   MAPK signaling pathway biu04020   Calcium signaling pathway biu04022   cGMP-PKG signaling pathway biu04114   Oocyte meiosis biu04218   Cellular senescence biu04310   Wnt signaling pathway biu04360   Axon guidance biu04370   VEGF signaling pathway biu04380   Osteoclast differentiation biu04625   C-type lectin receptor signaling pathway biu04650   Natural killer cell mediated cytotoxicity biu04658   Th1 and Th2 cell differentiation biu04659   Th17 cell differentiation biu04660   T cell receptor signaling pathway biu04662   B cell receptor signaling pathway biu04720   Long-term potentiation biu04724   Glutamatergic synapse biu04921   Oxytocin signaling pathway biu04922   Glucagon signaling pathway biu04924   Renin secretion biu05010   Alzheimer disease biu05014   Amyotrophic lateral sclerosis biu05020   Prion disease biu05022   Pathways of neurodegeneration - multiple diseases biu05031   Amphetamine addiction biu05152   Tuberculosis biu05163   Human cytomegalovirus infection biu05166   Human T-cell leukemia virus 1 infection biu05167   Kaposi sarcoma-associated herpesvirus infection biu05170   Human immunodeficiency virus 1 infection biu05235   PD-L1 expression and PD-1 checkpoint pathway in cancer biu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:biu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     109563306 (PPP3R2)    04310 Wnt signaling pathway     109563306 (PPP3R2)    04370 VEGF signaling pathway     109563306 (PPP3R2)    04020 Calcium signaling pathway     109563306 (PPP3R2)    04022 cGMP-PKG signaling pathway     109563306 (PPP3R2)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     109563306 (PPP3R2)    04218 Cellular senescence     109563306 (PPP3R2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     109563306 (PPP3R2)    04650 Natural killer cell mediated cytotoxicity     109563306 (PPP3R2)    04660 T cell receptor signaling pathway     109563306 (PPP3R2)    04658 Th1 and Th2 cell differentiation     109563306 (PPP3R2)    04659 Th17 cell differentiation     109563306 (PPP3R2)    04662 B cell receptor signaling pathway     109563306 (PPP3R2)   09152 Endocrine system    04922 Glucagon signaling pathway     109563306 (PPP3R2)    04921 Oxytocin signaling pathway     109563306 (PPP3R2)    04924 Renin secretion     109563306 (PPP3R2)   09156 Nervous system    04724 Glutamatergic synapse     109563306 (PPP3R2)    04720 Long-term potentiation     109563306 (PPP3R2)   09158 Development and regeneration    04360 Axon guidance     109563306 (PPP3R2)    04380 Osteoclast differentiation     109563306 (PPP3R2)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     109563306 (PPP3R2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     109563306 (PPP3R2)    05170 Human immunodeficiency virus 1 infection     109563306 (PPP3R2)    05163 Human cytomegalovirus infection     109563306 (PPP3R2)    05167 Kaposi sarcoma-associated herpesvirus infection     109563306 (PPP3R2)   09171 Infectious disease: bacterial    05152 Tuberculosis     109563306 (PPP3R2)   09164 Neurodegenerative disease    05010 Alzheimer disease     109563306 (PPP3R2)    05014 Amyotrophic lateral sclerosis     109563306 (PPP3R2)    05020 Prion disease     109563306 (PPP3R2)    05022 Pathways of neurodegeneration - multiple diseases     109563306 (PPP3R2)   09165 Substance dependence    05031 Amphetamine addiction     109563306 (PPP3R2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     109563306 (PPP3R2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:biu01009]     109563306 (PPP3R2) Protein phosphatases and associated proteins [BR:biu01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      109563306 (PPP3R2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_FSTL1 SPARC_Ca_bdg EH EF-hand_9 USP32_N Motif Other DBs NCBI-GeneID:  109563306 NCBI-ProteinID:  XP_019822223 UniProt:  A0A6P5C9T9 LinkDB All DBs Position 8:complement(96158325..96159279) Genome browser AA seq 170 aa AA seqDB search MGNEASYPAEICSHFDEDEIKRLRKRFKKLDLDSSSALSVKEFTSMPELQENPLVQRVID VFDTDGDGQVDFREFILGTSQFSVRGDEEQKLRFAFSIYDMDKDGYISNGELFQVLKMMV GDNLKDWQLQQLVDKTIILLDKDGDGKISFQEFSAVVRSLEXHKHLVTIV NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgggaaatgaggccagttacccggcggaratatgctcgcacttcgacgaagatgaaatt aaaaggctgcgcaagcgttttaagaagctggacttggacagttccagcgctctgagcgtc aaagagttcacgtccatgccrgagctgcaggagaacccgctggtgcagcgggtgatmgac gtcttcgacaccgacggcgacggacaggtggacttccgggaattcatcctggggacctcc cagttcagcgtccggggagatgaggagcagaagctgaggtttgctttcagcatctacgac atggacaaagacggctacatttccaacggggagctcttccaggtgctgaagatgatggta ggcgacaacctgaaagactggcagttacagcagctggtggacaaaaccatcatcctcctg gacaaagacggggacgggaaaatctccttccaggaattcagtgctgtggtcagaagcctg gagrtccacaagcacttggtgaccattgtgtga

DBGET integrated database retrieval system