Bos indicus (zebu cattle): 109564221 Help Entry 109564221         CDS       T04792                                  Symbol SST Name (RefSeq) somatostatin   KO K05237   somatostatin Organism biu  Bos indicus (zebu cattle) Pathway biu04024   cAMP signaling pathway biu04080   Neuroactive ligand-receptor interaction biu04081   Hormone signaling biu04935   Growth hormone synthesis, secretion and action biu04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:biu00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     109564221 (SST)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     109564221 (SST)    04081 Hormone signaling     109564221 (SST)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     109564221 (SST)   09154 Digestive system    04971 Gastric acid secretion     109564221 (SST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:biu04052]     109564221 (SST) Cytokines and neuropeptides [BR:biu04052]  Neuropeptides   GPCR binding    109564221 (SST) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Somatostatin NLRC4_HD2 Motif Other DBs NCBI-GeneID:  109564221 NCBI-ProteinID:  XP_019823314 UniProt:  A0A6P5CDB4 LinkDB All DBs Position 1:81451010..81452502 Genome browser AA seq 116 aa AA seqDB search MLSCRLQCALAALSIVLALGGVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEP NQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgctgtcctgccgcctccagtgcgcgctggccgcgctctccatcgtcctggctcttggc ggtgtcaccggcgcgccctcggatccccggctccgtcagtttctgcagaaatccctggct gctgctgctggcaagcaggaactggccaagtacttcttggcagagctgctgtctgaaccc aaccagacagagaatgatgccctggagcctgaagatttgtcccaggctgctgagcaggat gaaatgaggctggagctgcagagatctgctaactcaaacccggccatggcaccccgagaa cgcaaagctggctgcaagaatttcttctggaagactttcacatcctgttaa

DBGET integrated database retrieval system