Bos indicus (zebu cattle): 109564477 Help Entry 109564477         CDS       T04792                                  Symbol IL12A Name (RefSeq) interleukin-12 subunit alpha   KO K05406   interleukin 12A Organism biu  Bos indicus (zebu cattle) Pathway biu04060   Cytokine-cytokine receptor interaction biu04620   Toll-like receptor signaling pathway biu04622   RIG-I-like receptor signaling pathway biu04625   C-type lectin receptor signaling pathway biu04630   JAK-STAT signaling pathway biu04658   Th1 and Th2 cell differentiation biu04936   Alcoholic liver disease biu04940   Type I diabetes mellitus biu05133   Pertussis biu05134   Legionellosis biu05140   Leishmaniasis biu05142   Chagas disease biu05143   African trypanosomiasis biu05144   Malaria biu05145   Toxoplasmosis biu05146   Amoebiasis biu05152   Tuberculosis biu05162   Measles biu05164   Influenza A biu05168   Herpes simplex virus 1 infection biu05171   Coronavirus disease - COVID-19 biu05200   Pathways in cancer biu05321   Inflammatory bowel disease biu05330   Allograft rejection biu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:biu00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     109564477 (IL12A)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     109564477 (IL12A)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     109564477 (IL12A)    04622 RIG-I-like receptor signaling pathway     109564477 (IL12A)    04625 C-type lectin receptor signaling pathway     109564477 (IL12A)    04658 Th1 and Th2 cell differentiation     109564477 (IL12A)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109564477 (IL12A)   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     109564477 (IL12A)    05164 Influenza A     109564477 (IL12A)    05162 Measles     109564477 (IL12A)    05168 Herpes simplex virus 1 infection     109564477 (IL12A)   09171 Infectious disease: bacterial    05133 Pertussis     109564477 (IL12A)    05134 Legionellosis     109564477 (IL12A)    05152 Tuberculosis     109564477 (IL12A)   09174 Infectious disease: parasitic    05146 Amoebiasis     109564477 (IL12A)    05144 Malaria     109564477 (IL12A)    05145 Toxoplasmosis     109564477 (IL12A)    05140 Leishmaniasis     109564477 (IL12A)    05142 Chagas disease     109564477 (IL12A)    05143 African trypanosomiasis     109564477 (IL12A)   09163 Immune disease    05321 Inflammatory bowel disease     109564477 (IL12A)    05330 Allograft rejection     109564477 (IL12A)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     109564477 (IL12A)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     109564477 (IL12A)    04936 Alcoholic liver disease     109564477 (IL12A)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:biu04052]     109564477 (IL12A)    00536 Glycosaminoglycan binding proteins [BR:biu00536]     109564477 (IL12A) Cytokines and neuropeptides [BR:biu04052]  Cytokines   Interleukins    109564477 (IL12A) Glycosaminoglycan binding proteins [BR:biu00536]  Heparan sulfate / Heparin   Cytokines    109564477 (IL12A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL12 DUF8844 Motif Other DBs NCBI-GeneID:  109564477 NCBI-ProteinID:  XP_019823473 UniProt:  A0A6P5CDG3 LinkDB All DBs Position 1:complement(109241135..109248539) Genome browser AA seq 221 aa AA seqDB search MCPLRSLLLISTLVLLHHLPHLSLGRSLPTTTASPGRSCLDYSQNLLRAVSNTLQKARQT LEFYSCTSEEIDHEDITKDKTSTVEACLPLELATNESCLASRETSFITNGHCLASGKTSF MTTLCLRSIYEDLKMYHVEFQAMNAKLLMDPKRQIFLDQNMLAAIAELMQALNFDSETVP QKPSLKELDFYKTKVKLCILLHAFRIRAVTIDRMMSYLSSS NT seq 666 nt NT seq  +upstreamnt  +downstreamnt atgtgcccgcttcgcagcctcctcctcatatccaccctggttctcctccaccacctgccc cacctcagtttgggcaggagcctccccaccaccacagcaagcccaggaaggagctgcctc gactactcccaaaacctgctgagggctgtcagcaacacgctacagaaggccagacaaacc ctagaattttactcctgcacttctgaggagatcgatcatgaagatatcaccaaagataaa accagcacagtggaggcctgtttaccactggaattagccacgaatgagagttgcctggct tccagagagacctcttttataactaatgggcattgtctggcttctggaaagacctctttt atgacaaccctgtgccttagaagtatctatgaggacttgaagatgtaccacgtggagttc caggccatgaatgcaaagcttctgatggatcctaagaggcaaatctttctagaccagaac atgctggcagctattgctgagctgatgcaggccctgaatttcgacagtgagactgtgcca cagaaaccctccctgaaagaactggatttttacaagacaaaagtcaagctctgcatcctt cttcacgccttcagaattcgtgcggtgaccatcgacagaatgatgagctatctgagttct tcctag

DBGET integrated database retrieval system