Bos indicus (zebu cattle): 109564625 Help Entry 109564625         CDS       T04792                                  Symbol ATG12 Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism biu  Bos indicus (zebu cattle) Pathway biu04068   FoxO signaling pathway biu04136   Autophagy - other biu04140   Autophagy - animal biu04621   NOD-like receptor signaling pathway biu04622   RIG-I-like receptor signaling pathway Brite KEGG Orthology (KO) [BR:biu00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     109564625 (ATG12)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     109564625 (ATG12)    04136 Autophagy - other     109564625 (ATG12)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     109564625 (ATG12)    04622 RIG-I-like receptor signaling pathway     109564625 (ATG12)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:biu04131]     109564625 (ATG12)    04121 Ubiquitin system [BR:biu04121]     109564625 (ATG12)    03029 Mitochondrial biogenesis [BR:biu03029]     109564625 (ATG12) Membrane trafficking [BR:biu04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     109564625 (ATG12) Ubiquitin system [BR:biu04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    109564625 (ATG12) Mitochondrial biogenesis [BR:biu03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     109564625 (ATG12) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 ATG8 Motif Other DBs NCBI-GeneID:  109564625 NCBI-ProteinID:  XP_019823590 UniProt:  A0A6P5CD26 LinkDB All DBs Position 10:complement(4188819..4211078) Genome browser AA seq 128 aa AA seqDB search PSTAPEAEVPTEVSPETATPEPPSSAAVSPGTEEPVGDTKKKIDILLKAVGDTPIMKTKK WAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLH YCKSQAWG NT seq 387 nt NT seq  +upstreamnt  +downstreamnt ccctcaactgctcccgaagctgaagtgcctaccgaggtctccccagaaacagccactccg gagcccccttcttctgctgcagtttctccgggaacagaggaacctgtcggtgacaccaag aaaaaaattgacattctgctaaaggctgtaggagacactcctataatgaaaacaaagaaa tgggctgtagagcgaacccgaaccatccaaggactcattgacttcatcaaaaagttcctt aaacttgtggcttcagaacagttgtttatttacgtgaatcagtcctttgccccctcccca gaccaggaagttgggaccctctatgagtgttttggcagtgatggtaaactggtcctgcat tactgcaaatctcaagcatggggatga

DBGET integrated database retrieval system