Bos indicus (zebu cattle): 109564706 Help Entry 109564706         CDS       T04792                                  Name (RefSeq) stefin-C   KO K13907   cystatin-A/B Organism biu  Bos indicus (zebu cattle) Brite KEGG Orthology (KO) [BR:biu00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:biu01002]     109564706   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:biu04147]     109564706 Peptidases and inhibitors [BR:biu01002]  Peptidase inhibitors   Family I25: cystatin family    109564706 Exosome [BR:biu04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    109564706 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cystatin SQAPI Dynein_light Motif Other DBs NCBI-GeneID:  109564706 NCBI-ProteinID:  XP_019823738 UniProt:  A0A6P5CE83 LinkDB All DBs Position 1:147699213..147703486 Genome browser AA seq 101 aa AA seqDB search MWGPNLGGFSDTQDATAEIQAIADQVKSQLEEKENKKFPVFKAVKFRSQVVAGMNYLIKV QVDEDDFVHIRVFESLPHENKPVALTSYQTNKXRHDELTYF NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgtggggaccaaatcttggtgggttctcagatactcaggatgccacagccgagatccag gccatcgctgaccaggtgaagtcccagctggaggagaaggagaacaagaagttcccagtg ttcaaggctgtgaaattcaggagccaggtggttgctgggatgaactacttgatcaaggtt caagtggacgaggatgacttcgtgcacatccgagtgtttgaaagcctcccacacgagaac aagcccgtggccttgaccagctaccagaccaacaaargcaggcatgacgagctgacctac ttctag

DBGET integrated database retrieval system