Bos indicus (zebu cattle): 109564811 Help Entry 109564811         CDS       T04792                                  Symbol PSMB5 Name (RefSeq) proteasome subunit beta type-5   KO K02737   20S proteasome subunit beta 5 [EC:3.4.25.1] Organism biu  Bos indicus (zebu cattle) Pathway biu03050   Proteasome biu05010   Alzheimer disease biu05012   Parkinson disease biu05014   Amyotrophic lateral sclerosis biu05016   Huntington disease biu05017   Spinocerebellar ataxia biu05020   Prion disease biu05022   Pathways of neurodegeneration - multiple diseases Brite KEGG Orthology (KO) [BR:biu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     109564811 (PSMB5)  09160 Human Diseases   09164 Neurodegenerative disease    05010 Alzheimer disease     109564811 (PSMB5)    05012 Parkinson disease     109564811 (PSMB5)    05014 Amyotrophic lateral sclerosis     109564811 (PSMB5)    05016 Huntington disease     109564811 (PSMB5)    05017 Spinocerebellar ataxia     109564811 (PSMB5)    05020 Prion disease     109564811 (PSMB5)    05022 Pathways of neurodegeneration - multiple diseases     109564811 (PSMB5)  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:biu01002]     109564811 (PSMB5)   09182 Protein families: genetic information processing    03051 Proteasome [BR:biu03051]     109564811 (PSMB5) Enzymes [BR:biu01000]  3. Hydrolases   3.4  Acting on peptide bonds (peptidases)    3.4.25  Threonine endopeptidases     3.4.25.1  proteasome endopeptidase complex      109564811 (PSMB5) Peptidases and inhibitors [BR:biu01002]  Threonine peptidases   Family T1: proteasome family    109564811 (PSMB5) Proteasome [BR:biu03051]  Eukaryotic proteasome   Core particles (20S proteasome)    beta type subunits     109564811 (PSMB5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Proteasome DUF3991 Motif Other DBs NCBI-GeneID:  109564811 NCBI-ProteinID:  XP_019823911 UniProt:  A0A6P5CDJ5 LinkDB All DBs Position 10:22112931..22117193 Genome browser AA seq 160 aa AA seqDB search MAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGW DKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEEAYDLARRAIYQAT YRDAYSGGSVSLYHVREDGWIRVSSDNVADLHDKYSGSTH NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atggctgggggtgcagcggattgcagcttctgggagaggctgttggctcggcaatgtcga atctatgagcttcgaaacaaggaacgcatctccgtagcagctgcctccaagctgcttgcc aacatggtgtatcagtataaaggcatggggctstccatgggcaccatgatctgtggctgg gataagaggggccctggcctctactacgtggacagtgaaggaaaccggatctcaggggcc accttctctgtaggttctggctctgtatatgcttacggggtcatggatcggggttactcc tatgacctggaggtggaggaggcctatgatctggcccgtcgagccatctaccaagccacc tacagagatgcctactcaggaggttccgtcagcctctaccatgtcagggaggatggctgg atccgggtctccagtgacaatgtcgctgatctacatgacaagtatagtggatctacccac tga

DBGET integrated database retrieval system