Bos indicus (zebu cattle): 109566132 Help Entry 109566132         CDS       T04792                                  Symbol IL1A Name (RefSeq) interleukin-1 alpha   KO K04383   interleukin 1 alpha Organism biu  Bos indicus (zebu cattle) Pathway biu04010   MAPK signaling pathway biu04060   Cytokine-cytokine receptor interaction biu04217   Necroptosis biu04218   Cellular senescence biu04380   Osteoclast differentiation biu04640   Hematopoietic cell lineage biu04932   Non-alcoholic fatty liver disease biu04933   AGE-RAGE signaling pathway in diabetic complications biu04940   Type I diabetes mellitus biu05010   Alzheimer disease biu05020   Prion disease biu05022   Pathways of neurodegeneration - multiple diseases biu05133   Pertussis biu05140   Leishmaniasis biu05152   Tuberculosis biu05162   Measles biu05164   Influenza A biu05321   Inflammatory bowel disease biu05323   Rheumatoid arthritis biu05332   Graft-versus-host disease biu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:biu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     109566132 (IL1A)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     109566132 (IL1A)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     109566132 (IL1A)    04218 Cellular senescence     109566132 (IL1A)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     109566132 (IL1A)   09158 Development and regeneration    04380 Osteoclast differentiation     109566132 (IL1A)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     109566132 (IL1A)    05162 Measles     109566132 (IL1A)   09171 Infectious disease: bacterial    05133 Pertussis     109566132 (IL1A)    05152 Tuberculosis     109566132 (IL1A)   09174 Infectious disease: parasitic    05140 Leishmaniasis     109566132 (IL1A)   09163 Immune disease    05323 Rheumatoid arthritis     109566132 (IL1A)    05321 Inflammatory bowel disease     109566132 (IL1A)    05332 Graft-versus-host disease     109566132 (IL1A)   09164 Neurodegenerative disease    05010 Alzheimer disease     109566132 (IL1A)    05020 Prion disease     109566132 (IL1A)    05022 Pathways of neurodegeneration - multiple diseases     109566132 (IL1A)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     109566132 (IL1A)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     109566132 (IL1A)    04932 Non-alcoholic fatty liver disease     109566132 (IL1A)    04933 AGE-RAGE signaling pathway in diabetic complications     109566132 (IL1A)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:biu04052]     109566132 (IL1A) Cytokines and neuropeptides [BR:biu04052]  Cytokines   Interleukins    109566132 (IL1A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL1_propep IL1 DUF4937 Motif Other DBs NCBI-GeneID:  109566132 NCBI-ProteinID:  XP_019825812 UniProt:  A0A6P5CLP5 LinkDB All DBs Position 11:complement(48253723..48265047) Genome browser AA seq 268 aa AA seqDB search MAKVPDLFEDLKNCYSENEDYTSEIDHLSLNQKSFYDASYEPLREDQMNKFMSLDTSETS KTSKLSFKENVVMVAASGKILKKRRLSLNQFITDDDLEAIANNTEEEIIKPRSAHYSFQS NVKYNFMRVIHQECILNDALNQSIIRDMSGPYLTATTLNNLEEAVKFDMVAYVSEEDSQL PVTLRISKTQLFVSAQNEDEPVLLKEMPETPKIIKDETNLLFFWEKHGSMDYFKSVAHPK LFIATKQEKLVHMASGPPSITDFQILEK NT seq 807 nt NT seq  +upstreamnt  +downstreamnt atggccaaagtccctgacctctttgaagacctgaagaactgttacagtgaaaatgaagac tacacttctgaaattgaccacctctctctcaatcagaagtccttctatgatgcaagctat gagccacttcgtgaggaccagatgaataagtttatgtccctggatacctcggaaacctct aagacatccaagcttagcttcaaggagaatgtggtgatggtggcagccagtgggaagatt ctgaagaagagacggttgagtttaaatcagttcatcaccgatgatgacctggaagccatt gccaataacacagaagaagaaatcatcaagcccagatcagcacattacagcttccagagt aacgtgaaatacaactttatgagagtcatccaccaggaatgcatcctgaacgacgccctc aatcaaagtataattcgagatatgtcaggtccatacctgacggctactacattaaataat ctggaggaggcagtgaaatttgacatggttgcttatgtatcagaagaggattctcagctt cctgtgactctaagaatctcaaaaactcaactgtttgtgagtgctcaaaatgaagacgaa cccgtcttgctaaaggagatgcctgagacacccaaaatcatcaaagatgagaccaacctc ctcttcttctgggaaaagcatggctctatggactacttcaaatcagttgcccatccaaag ttgtttattgccacaaagcaagaaaaattggtgcacatggcaagtgggccgccctcgatc actgactttcagatattggaaaaatag

DBGET integrated database retrieval system