Bos indicus (zebu cattle): 109566133 Help Entry 109566133         CDS       T04792                                  Symbol IL1B Name (RefSeq) interleukin-1 beta   KO K04519   interleukin 1 beta Organism biu  Bos indicus (zebu cattle) Pathway biu01523   Antifolate resistance biu04010   MAPK signaling pathway biu04060   Cytokine-cytokine receptor interaction biu04064   NF-kappa B signaling pathway biu04217   Necroptosis biu04380   Osteoclast differentiation biu04620   Toll-like receptor signaling pathway biu04621   NOD-like receptor signaling pathway biu04623   Cytosolic DNA-sensing pathway biu04625   C-type lectin receptor signaling pathway biu04640   Hematopoietic cell lineage biu04657   IL-17 signaling pathway biu04659   Th17 cell differentiation biu04668   TNF signaling pathway biu04750   Inflammatory mediator regulation of TRP channels biu04932   Non-alcoholic fatty liver disease biu04933   AGE-RAGE signaling pathway in diabetic complications biu04936   Alcoholic liver disease biu04940   Type I diabetes mellitus biu05010   Alzheimer disease biu05020   Prion disease biu05022   Pathways of neurodegeneration - multiple diseases biu05132   Salmonella infection biu05133   Pertussis biu05134   Legionellosis biu05135   Yersinia infection biu05140   Leishmaniasis biu05142   Chagas disease biu05143   African trypanosomiasis biu05144   Malaria biu05146   Amoebiasis biu05152   Tuberculosis biu05162   Measles biu05163   Human cytomegalovirus infection biu05164   Influenza A biu05168   Herpes simplex virus 1 infection biu05171   Coronavirus disease - COVID-19 biu05321   Inflammatory bowel disease biu05323   Rheumatoid arthritis biu05332   Graft-versus-host disease biu05417   Lipid and atherosclerosis biu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:biu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     109566133 (IL1B)    04064 NF-kappa B signaling pathway     109566133 (IL1B)    04668 TNF signaling pathway     109566133 (IL1B)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     109566133 (IL1B)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     109566133 (IL1B)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     109566133 (IL1B)    04620 Toll-like receptor signaling pathway     109566133 (IL1B)    04621 NOD-like receptor signaling pathway     109566133 (IL1B)    04623 Cytosolic DNA-sensing pathway     109566133 (IL1B)    04625 C-type lectin receptor signaling pathway     109566133 (IL1B)    04659 Th17 cell differentiation     109566133 (IL1B)    04657 IL-17 signaling pathway     109566133 (IL1B)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     109566133 (IL1B)   09158 Development and regeneration    04380 Osteoclast differentiation     109566133 (IL1B)  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     109566133 (IL1B)    05164 Influenza A     109566133 (IL1B)    05162 Measles     109566133 (IL1B)    05168 Herpes simplex virus 1 infection     109566133 (IL1B)    05163 Human cytomegalovirus infection     109566133 (IL1B)   09171 Infectious disease: bacterial    05132 Salmonella infection     109566133 (IL1B)    05135 Yersinia infection     109566133 (IL1B)    05133 Pertussis     109566133 (IL1B)    05134 Legionellosis     109566133 (IL1B)    05152 Tuberculosis     109566133 (IL1B)   09174 Infectious disease: parasitic    05146 Amoebiasis     109566133 (IL1B)    05144 Malaria     109566133 (IL1B)    05140 Leishmaniasis     109566133 (IL1B)    05142 Chagas disease     109566133 (IL1B)    05143 African trypanosomiasis     109566133 (IL1B)   09163 Immune disease    05323 Rheumatoid arthritis     109566133 (IL1B)    05321 Inflammatory bowel disease     109566133 (IL1B)    05332 Graft-versus-host disease     109566133 (IL1B)   09164 Neurodegenerative disease    05010 Alzheimer disease     109566133 (IL1B)    05020 Prion disease     109566133 (IL1B)    05022 Pathways of neurodegeneration - multiple diseases     109566133 (IL1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     109566133 (IL1B)    05418 Fluid shear stress and atherosclerosis     109566133 (IL1B)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     109566133 (IL1B)    04936 Alcoholic liver disease     109566133 (IL1B)    04932 Non-alcoholic fatty liver disease     109566133 (IL1B)    04933 AGE-RAGE signaling pathway in diabetic complications     109566133 (IL1B)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     109566133 (IL1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:biu04052]     109566133 (IL1B)    00536 Glycosaminoglycan binding proteins [BR:biu00536]     109566133 (IL1B) Cytokines and neuropeptides [BR:biu04052]  Cytokines   Interleukins    109566133 (IL1B) Glycosaminoglycan binding proteins [BR:biu00536]  Heparan sulfate / Heparin   Cytokines    109566133 (IL1B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL1 IL1_propep TTC5_OB Motif Other DBs NCBI-GeneID:  109566133 NCBI-ProteinID:  XP_019825813 UniProt:  A0A6P5CJY3 LinkDB All DBs Position 11:complement(48315576..48323987) Genome browser AA seq 266 aa AA seqDB search MATVPEPINEMMAYYSDENELLFEADDPKQMKSCIQHLDLGSMGDGNIQLQISHQFYNKS FRQVVSVIVAMEKLRNSAYAHVFHDDDLRSILSFIFEEEPVIFETSSDEFLCDAPVQSIK CKLQDREQKSLVLASPCVLKALHLLSQEMNREVVFCMSFVQGEERDNKIPVALGIKDKNL YLSCVKKGDTPTLQLEEVDPKVYPKRNMEKRFVFYKTEIKNTVEFESVLYPNWYISTSQI EERPVFLGHFRGGQDITDFRMETLSP NT seq 801 nt NT seq  +upstreamnt  +downstreamnt atggcaaccgtacctgaacccatcaacgaaatgatggcttactacagtgacgagaatgag ctgttatttgaggctgatgaccctaaacagatgaagagctgcatccaacacctggacctc ggttccatgggagatggaaacatccagctgcagatttctcaccagttctacaacaaaagc ttcaggcaggtggtgtcggtcatygtggccatggagaagctgaggaacagtgcctacgca catgtcttccatgatgatgacctgaggagcatcctttcattcatctttgaagaagagcct gtcatcttcgaaacgtcctccgacgagtttctgtgtgacgcacccgtgcagtcaataaag tgcaaactccaggacagagagcaaaaatccctggtgctggctagcccatgtgtgctgaag gctctccacctcctctcacaggaaatgaaccgagaagtggtgttctgcatgagctttgtg caaggagaggaaagagacaacaagattcctgtggccttgggtatcaaggacaagaatcta tacctgtcttgtgtgaaaaaaggtgatacgcccaccctgcagctggaggaagtagacccc aaagtctaccccaagaggaatatggaaaagcgctttgtcttctacaagacagaaatcaag aatacagttgaatttgagtctgtcctgtaccctaactggtacatcagcacttctcaaatc gaagaaaggcccgtcttcctgggacattttcgaggtggccaggatataactgacttcaga atggaaaccctctctccctaa

DBGET integrated database retrieval system