Bos indicus (zebu cattle): 109566339 Help Entry 109566339         CDS       T04792                                  Symbol PFN4 Name (RefSeq) profilin-4   KO K05759   profilin Organism biu  Bos indicus (zebu cattle) Pathway biu04015   Rap1 signaling pathway biu04810   Regulation of actin cytoskeleton biu05014   Amyotrophic lateral sclerosis biu05132   Salmonella infection Brite KEGG Orthology (KO) [BR:biu00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     109566339 (PFN4)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     109566339 (PFN4)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     109566339 (PFN4)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     109566339 (PFN4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:biu04131]     109566339 (PFN4)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:biu04812]     109566339 (PFN4)    04147 Exosome [BR:biu04147]     109566339 (PFN4) Membrane trafficking [BR:biu04131]  Others   Actin-binding proteins    Others     109566339 (PFN4) Cytoskeleton proteins [BR:biu04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      109566339 (PFN4) Exosome [BR:biu04147]  Exosomal proteins   Proteins found in most exosomes    109566339 (PFN4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  109566339 NCBI-ProteinID:  XP_019826185 UniProt:  A0A6P5CKK3 LinkDB All DBs Position 11:77201940..77206102 Genome browser AA seq 129 aa AA seqDB search MSHLQNLLLDTLLGTKHVDSAALIKLQERSLCVASPGFSVMPSDVRTLVNGFAKNPLKTR REGLYFKEKDYKCVRADDYSLYAKNENTGVIVVKTHLYLLVATYSEGMYPSVCVEATEKL GDYLRRKGN NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgagccatttgcagaacttactgttagatacactcctgggaacaaagcatgtggacagt gcagccctcatcaaactccaggagcggagcctatgtgtagcatcaccaggatttagtgta atgcccagtgatgtccgaacacttgtaaatgggtttgccaagaaccctttgaaaaccaga agagaaggactgtatttcaaggagaaggactacaaatgtgtccgggcagatgactattct ctttatgccaagaatgaaaacactggtgtgattgttgtgaagacccatctgtatcttctg gtggcaacttactctgaaggcatgtatcctagtgtctgtgtggaagccacagagaagttg ggagactatctaagaagaaaagggaattaa

DBGET integrated database retrieval system