Bos indicus (zebu cattle): 109569246 Help Entry 109569246         CDS       T04792                                  Name (RefSeq) histone H3-like   KO K11253   histone H3 Organism biu  Bos indicus (zebu cattle) Pathway biu04613   Neutrophil extracellular trap formation biu05034   Alcoholism biu05202   Transcriptional misregulation in cancer biu05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:biu00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     109569246  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     109569246   09163 Immune disease    05322 Systemic lupus erythematosus     109569246   09165 Substance dependence    05034 Alcoholism     109569246  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:biu03036]     109569246   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:biu04147]     109569246 Chromosome and associated proteins [BR:biu03036]  Eukaryotic type   Nucleosome assembly factors    Histones     109569246 Exosome [BR:biu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    109569246 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C CENP-S PAF YebU_pre-PUA_dom CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-GeneID:  109569246 NCBI-ProteinID:  XP_019830124 UniProt:  A0A6P5CY97 LinkDB All DBs Position 2:93009623..93010033 Genome browser AA seq 136 aa AA seqDB search MXRTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLXFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atgrcgcgtacgaagcagaccgcccggaagtcsactggtggcaaggccccgcggaagcag ctggccaccaaggcggctcgcaagagcgcgccggccacgggcggcgtcaagaagccgcat cgttataggccgggcaccgtggccctgcgggagattcggcgctaccagaagtcgaccgag ctgctgatccgcaagctgcygttccagcggctggtacgcgagatcgcgcaggactttaag accgatctgcgcttccagagctcggccgtgatggcgctgcaggaggcgagcgaggcctac ctggtggggctgtttgaagacacgaacctgtgcgccatccacgccaagcgcgtgaccaty atgcccaaagacatccagctggctcgtcgcatccgcggggagcgggcttaa

DBGET integrated database retrieval system