Bos indicus (zebu cattle): 109571778 Help Entry 109571778         CDS       T04792                                  Symbol BAX Name (RefSeq) apoptosis regulator BAX   KO K02159   apoptosis regulator BAX Organism biu  Bos indicus (zebu cattle) Pathway biu01521   EGFR tyrosine kinase inhibitor resistance biu01522   Endocrine resistance biu01524   Platinum drug resistance biu04071   Sphingolipid signaling pathway biu04115   p53 signaling pathway biu04141   Protein processing in endoplasmic reticulum biu04210   Apoptosis biu04211   Longevity regulating pathway biu04215   Apoptosis - multiple species biu04217   Necroptosis biu04722   Neurotrophin signaling pathway biu04932   Non-alcoholic fatty liver disease biu04933   AGE-RAGE signaling pathway in diabetic complications biu05012   Parkinson disease biu05014   Amyotrophic lateral sclerosis biu05016   Huntington disease biu05020   Prion disease biu05022   Pathways of neurodegeneration - multiple diseases biu05132   Salmonella infection biu05152   Tuberculosis biu05160   Hepatitis C biu05161   Hepatitis B biu05162   Measles biu05163   Human cytomegalovirus infection biu05164   Influenza A biu05165   Human papillomavirus infection biu05166   Human T-cell leukemia virus 1 infection biu05167   Kaposi sarcoma-associated herpesvirus infection biu05168   Herpes simplex virus 1 infection biu05169   Epstein-Barr virus infection biu05170   Human immunodeficiency virus 1 infection biu05200   Pathways in cancer biu05202   Transcriptional misregulation in cancer biu05203   Viral carcinogenesis biu05210   Colorectal cancer biu05212   Pancreatic cancer biu05213   Endometrial cancer biu05214   Glioma biu05216   Thyroid cancer biu05217   Basal cell carcinoma biu05218   Melanoma biu05220   Chronic myeloid leukemia biu05222   Small cell lung cancer biu05223   Non-small cell lung cancer biu05224   Breast cancer biu05225   Hepatocellular carcinoma biu05226   Gastric cancer biu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:biu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     109571778 (BAX)  09130 Environmental Information Processing   09132 Signal transduction    04071 Sphingolipid signaling pathway     109571778 (BAX)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     109571778 (BAX)    04215 Apoptosis - multiple species     109571778 (BAX)    04217 Necroptosis     109571778 (BAX)    04115 p53 signaling pathway     109571778 (BAX)  09150 Organismal Systems   09156 Nervous system    04722 Neurotrophin signaling pathway     109571778 (BAX)   09149 Aging    04211 Longevity regulating pathway     109571778 (BAX)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109571778 (BAX)    05202 Transcriptional misregulation in cancer     109571778 (BAX)    05203 Viral carcinogenesis     109571778 (BAX)   09162 Cancer: specific types    05210 Colorectal cancer     109571778 (BAX)    05212 Pancreatic cancer     109571778 (BAX)    05225 Hepatocellular carcinoma     109571778 (BAX)    05226 Gastric cancer     109571778 (BAX)    05214 Glioma     109571778 (BAX)    05216 Thyroid cancer     109571778 (BAX)    05220 Chronic myeloid leukemia     109571778 (BAX)    05217 Basal cell carcinoma     109571778 (BAX)    05218 Melanoma     109571778 (BAX)    05213 Endometrial cancer     109571778 (BAX)    05224 Breast cancer     109571778 (BAX)    05222 Small cell lung cancer     109571778 (BAX)    05223 Non-small cell lung cancer     109571778 (BAX)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     109571778 (BAX)    05170 Human immunodeficiency virus 1 infection     109571778 (BAX)    05161 Hepatitis B     109571778 (BAX)    05160 Hepatitis C     109571778 (BAX)    05164 Influenza A     109571778 (BAX)    05162 Measles     109571778 (BAX)    05168 Herpes simplex virus 1 infection     109571778 (BAX)    05163 Human cytomegalovirus infection     109571778 (BAX)    05167 Kaposi sarcoma-associated herpesvirus infection     109571778 (BAX)    05169 Epstein-Barr virus infection     109571778 (BAX)    05165 Human papillomavirus infection     109571778 (BAX)   09171 Infectious disease: bacterial    05132 Salmonella infection     109571778 (BAX)    05152 Tuberculosis     109571778 (BAX)   09164 Neurodegenerative disease    05012 Parkinson disease     109571778 (BAX)    05014 Amyotrophic lateral sclerosis     109571778 (BAX)    05016 Huntington disease     109571778 (BAX)    05020 Prion disease     109571778 (BAX)    05022 Pathways of neurodegeneration - multiple diseases     109571778 (BAX)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     109571778 (BAX)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     109571778 (BAX)    04933 AGE-RAGE signaling pathway in diabetic complications     109571778 (BAX)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     109571778 (BAX)    01524 Platinum drug resistance     109571778 (BAX)    01522 Endocrine resistance     109571778 (BAX)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:biu03029]     109571778 (BAX)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:biu02000]     109571778 (BAX) Mitochondrial biogenesis [BR:biu03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Fission and Fusion factors     109571778 (BAX) Transporters [BR:biu02000]  Other transporters   Pores ion channels [TC:1]    109571778 (BAX) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 Motif Other DBs NCBI-GeneID:  109571778 NCBI-ProteinID:  XP_019833858 UniProt:  A0A6P5D6N6 LinkDB All DBs Position 18:55356396..55359191 Genome browser AA seq 174 aa AA seqDB search MKTGALLLQGFIQDRAGRMGGETPELGLEQVPQDASTKKLSECLKRIGDELDSNMELQRM IAAVDTDSPREVFFRVAAEMFSDGNFNWGRVVALFYFASKLVLKVGGCRALSPGRLPSGL RGPGSHEVNPRDSPETTEGMERVSYGPLISFFIHVFIHSAWASLVAQMVGTKEP NT seq 525 nt NT seq  +upstreamnt  +downstreamnt atgaagacaggggcccttttgcttcagggtttcatccaggatcgagcagggcgaatgggg ggagagacacccgagctgggcttggagcaggtgccccaggatgcatccaccaagaagctg agcgagtgtctgaagcgcatcggagatgaattggacagtaacatggagctgcagaggatg atcgcagctgtggacacagactctccccgagaggtctttttccgagtggcggctgaaatg ttttctgacggcaacttcaactggggccgggttgtcgcccttttctactttgccagcaaa ctggtgctcaaggtgggcggctgcagggccctgagcccagggaggctcccttcaggcctg agaggacctgggagtcatgaggtcaaccctcgggacagcccggaaaccacagagggaatg gagagagtcagctatgggccactcatcagctttttcattcatgtatttattcactcagca tgggcttccctagtggctcagatggtaggtaccaaggagccataa

DBGET integrated database retrieval system