Bos indicus (zebu cattle): 109572074 Help Entry 109572074         CDS       T04792                                  Symbol FGF21 Name (RefSeq) fibroblast growth factor 21   KO K22429   fibroblast growth factor 21 Organism biu  Bos indicus (zebu cattle) Pathway biu04010   MAPK signaling pathway biu04014   Ras signaling pathway biu04015   Rap1 signaling pathway biu04020   Calcium signaling pathway biu04151   PI3K-Akt signaling pathway biu04714   Thermogenesis biu04810   Regulation of actin cytoskeleton biu05200   Pathways in cancer biu05218   Melanoma biu05224   Breast cancer biu05226   Gastric cancer Brite KEGG Orthology (KO) [BR:biu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     109572074 (FGF21)    04014 Ras signaling pathway     109572074 (FGF21)    04015 Rap1 signaling pathway     109572074 (FGF21)    04020 Calcium signaling pathway     109572074 (FGF21)    04151 PI3K-Akt signaling pathway     109572074 (FGF21)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     109572074 (FGF21)  09150 Organismal Systems   09159 Environmental adaptation    04714 Thermogenesis     109572074 (FGF21)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109572074 (FGF21)   09162 Cancer: specific types    05226 Gastric cancer     109572074 (FGF21)    05218 Melanoma     109572074 (FGF21)    05224 Breast cancer     109572074 (FGF21)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:biu04052]     109572074 (FGF21)    00536 Glycosaminoglycan binding proteins [BR:biu00536]     109572074 (FGF21) Cytokines and neuropeptides [BR:biu04052]  Cytokines   Growth factors (RTK binding)    109572074 (FGF21) Glycosaminoglycan binding proteins [BR:biu00536]  Heparan sulfate / Heparin   Growth factors/receptors    109572074 (FGF21) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FGF Motif Other DBs NCBI-GeneID:  109572074 NCBI-ProteinID:  XP_019834172 UniProt:  A0A6P5DAY7 LinkDB All DBs Position 18:55207412..55210032 Genome browser AA seq 209 aa AA seqDB search MGWDEAKFKHLGLWVPVLAVLLLGTCRAHPIPDSSPLLQFGGQVRQRYLYTDDAQETEAH LEIRADGTVVGAARQSPESLLELKALKPGVIQILGVKTSRFLCQGPDGKLYGSLHFDPKA CSFRELLLEDGYNVYQSETLGLPLRLPPQRSSNRDPAPRGPARFLPLPGLPAAPPDPPGI LAPEPPDVGSSDPLSMVGPSYGRSPSYTS NT seq 630 nt NT seq  +upstreamnt  +downstreamnt atgggctgggacgaggccaagttcaagcacttgggactgtgggtccctgtgctggctgtc ctcctgctaggaacctgccgggcgcatcccattccagactccagccccctcctccagttt gggggccaagtccgccagcggtacctctacacggatgaygcccaggagacagaggcccac ctggagatcagggccgatggcacagtggtgggggcagcccgccagagccccgaaagtctc ttggagctgaaagccctgaagccaggcgtcattcagatcttgggagttaaaacatccagg tttctctgccaggggccagatgggaagctgtacggatcgctgcactttgaccccaaagcc tgcagctttcgggagctgcttcttgaagatggatacaacgtctaccagtcggagaccctg ggccttccactccgcctgcccccccagcgctcgtccaaccgggacccggccccgcgggga cctgctcgcttccttccactgccgggcctgcccgcggcgcccccggatcctccagggatc ttggcccccgagcctcccgacgtgggctcctcggatcccctgagtatggtgggaccctcg tatggccgaagccccagctacacttcttga

DBGET integrated database retrieval system