Bos indicus (zebu cattle): 109572222 Help Entry 109572222         CDS       T04792                                  Symbol RRAS Name (RefSeq) ras-related protein R-Ras   KO K07829   Ras-related protein R-Ras Organism biu  Bos indicus (zebu cattle) Pathway biu04010   MAPK signaling pathway biu04014   Ras signaling pathway biu04015   Rap1 signaling pathway biu04024   cAMP signaling pathway biu04072   Phospholipase D signaling pathway biu04137   Mitophagy - animal biu04140   Autophagy - animal biu04218   Cellular senescence biu04360   Axon guidance biu04371   Apelin signaling pathway biu04625   C-type lectin receptor signaling pathway biu04810   Regulation of actin cytoskeleton biu05132   Salmonella infection biu05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:biu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     109572222 (RRAS)    04014 Ras signaling pathway     109572222 (RRAS)    04015 Rap1 signaling pathway     109572222 (RRAS)    04371 Apelin signaling pathway     109572222 (RRAS)    04072 Phospholipase D signaling pathway     109572222 (RRAS)    04024 cAMP signaling pathway     109572222 (RRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     109572222 (RRAS)    04137 Mitophagy - animal     109572222 (RRAS)   09143 Cell growth and death    04218 Cellular senescence     109572222 (RRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     109572222 (RRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     109572222 (RRAS)   09158 Development and regeneration    04360 Axon guidance     109572222 (RRAS)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     109572222 (RRAS)   09171 Infectious disease: bacterial    05132 Salmonella infection     109572222 (RRAS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:biu04031]     109572222 (RRAS) GTP-binding proteins [BR:biu04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     109572222 (RRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 AAA_22 Motif Other DBs NCBI-GeneID:  109572222 NCBI-ProteinID:  XP_019834365 UniProt:  A0A6P5D9I0 LinkDB All DBs Position 18:complement(55997428..56001280) Genome browser AA seq 218 aa AA seqDB search MSSGAASGTGRXXPRGGVPGPGDPPPSETHKLVVVGGGGVGKSALTIQFIQSYFVSDYDP TIEDSYTKICTVDGVPARLDILDTAGQEEFGAMREQYMRAGHGFLLVFAINDRQSFNEVG KLFTQILRVKDRDDFPVVLVGNKADLETQRQVPRSEASTFSASHHVAYFEASAKLRLNVD EAFEQLVRAVRKYQEQELPPSPPSAPRKKAGGCPCVLL NT seq 657 nt NT seq  +upstreamnt  +downstreamnt atgagcagcggggcggcgtccgggacagggcgnnnnnngccccggggcggggtgccggga cccggggaccccccacccagcgagacacacaagctggtggtcgtgggcggcggcggcgtg ggcaagagcgcgctgaccatccagttcatccagtcctacttcgtgtctgactacgacccc actatcgaagactcctacacgaagatctgcactgtggatggcgtcccagcccggctagac attctggacaccgccggccaggaggagtttggtgccatgcgggaacagtacatgcgtgca ggccatggcttcctgctggtgtttgccattaatgacaggcagagtttcaacgaagtgggc aagctcttcacgcagatccttcgagtcaaggaccgagacgacttccccgtcgtgttggtt ggcaacaaggcggatctggaaacacagcgccaggtccctcgatctgaagcctccaccttc agtgcctcccaccacgtggcctacttcgaagcttctgccaaactgcgcctcaacgtggat gaagccttcgagcagctggtgcgggctgtccggaagtaccaggaacaagagctcccgccc tccccgcccagcgcccccaggaagaaggccggaggttgcccctgtgtccttctgtag

DBGET integrated database retrieval system