Bos indicus (zebu cattle): 109572248 Help Entry 109572248         CDS       T04792                                  Symbol CCL22 Name (RefSeq) C-C motif chemokine 22   KO K21095   C-C motif chemokine 22 Organism biu  Bos indicus (zebu cattle) Pathway biu04060   Cytokine-cytokine receptor interaction biu04061   Viral protein interaction with cytokine and cytokine receptor biu04062   Chemokine signaling pathway biu04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:biu00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     109572248 (CCL22)    04061 Viral protein interaction with cytokine and cytokine receptor     109572248 (CCL22)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     109572248 (CCL22)    04062 Chemokine signaling pathway     109572248 (CCL22)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:biu04052]     109572248 (CCL22) Cytokines and neuropeptides [BR:biu04052]  Cytokines   Chemokines    109572248 (CCL22) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  109572248 NCBI-ProteinID:  XP_019834411 UniProt:  A0A6P5D829 LinkDB All DBs Position 18:25288263..25296304 Genome browser AA seq 93 aa AA seqDB search MASLQTPLLAALILLAMILQATEAGPYGANVEDSVCCRDYIRYPLPLRLVKYYYWTSNSC RRPGVVLLTVKDREICADPKQHWVKKILQKLNQ NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggccagcctgcagacccctctcctggctgccctcatcctcctggctatgatacttcaa gcaacagaggcaggcccctacggtgccaacgtggaggacagcgtctgttgccgggactac atccgttaccctctgcccctgcgtttggtgaaatattactactggacttcaaattcctgc cggagacctggcgtggtcttgctgactgtgaaggaccgagagatctgtgctgaccccaaa cagcactgggtgaagaagattctccagaagctgaaccaatga

DBGET integrated database retrieval system