Bos indicus (zebu cattle): 109573460 Help Entry 109573460         CDS       T04792                                  Symbol GAST Name (RefSeq) gastrin   KO K13768   gastrin Organism biu  Bos indicus (zebu cattle) Pathway biu04081   Hormone signaling biu04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:biu00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04081 Hormone signaling     109573460 (GAST)  09150 Organismal Systems   09154 Digestive system    04971 Gastric acid secretion     109573460 (GAST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:biu04052]     109573460 (GAST) Cytokines and neuropeptides [BR:biu04052]  Neuropeptides   GPCR binding    109573460 (GAST) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Gastrin Motif Other DBs NCBI-GeneID:  109573460 NCBI-ProteinID:  XP_019836255 UniProt:  A0A6P5DFS1 LinkDB All DBs Position 19:43280665..43288154 Genome browser AA seq 104 aa AA seqDB search MQRLCAHVLILVLALAAFCEASWKPHSHLQDAPVAPGANRGQEPLRMNRLGPASHPRRQL GLQDPPHMVADLSKKQGPWVEEEEAAYGWMDFGRRSAEEGDQHP NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgcagcgactgtgtgcacatgtgctgatcttggtgctggctctggccgccttctgcgaa gcttcttggaagccccactcccacctgcaagacgcgcccgtcgctccaggggccaatagg ggccaggagccgctcaggatgaaccggctgggcccagcctcgcacccccggaggcagctg gggcttcaggatccgccacacatggtcgcagacctgtccaagaagcaggggccatgggtg gaggaagaggaagcagcatatggatggatggacttcggccgccgcagtgctgaggaaggg gaccaacatccctga

DBGET integrated database retrieval system