Bos indicus (zebu cattle): 109573674 Help Entry 109573674         CDS       T04792                                  Name (RefSeq) histone H3.3   KO K11253   histone H3 Organism biu  Bos indicus (zebu cattle) Pathway biu04613   Neutrophil extracellular trap formation biu05034   Alcoholism biu05202   Transcriptional misregulation in cancer biu05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:biu00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     109573674  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     109573674   09163 Immune disease    05322 Systemic lupus erythematosus     109573674   09165 Substance dependence    05034 Alcoholism     109573674  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:biu03036]     109573674   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:biu04147]     109573674 Chromosome and associated proteins [BR:biu03036]  Eukaryotic type   Nucleosome assembly factors    Histones     109573674 Exosome [BR:biu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    109573674 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-GeneID:  109573674 NCBI-ProteinID:  XP_019836582 UniProt:  A0A6P5DHD0 LinkDB All DBs Position 19:57544757..57548353 Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgaaccaagcagactgctcgtaagtcaacgggtgggaaagcgccccgcaagcag ctggccaccaaagcggccaggaaaagcgccccctctactggcggggtgaaaaaacctcat cgctacaggcccgggactgttgcgcttcgagaaatccgtcgttaccagaaatccaccgag cttctgatccggaaactgcctttccagaggttggtgagggagatcgcccaggatttcaaa accgacttgaggttccagagtgccgccatcggcgcgctgcaggaggctagcgaagcgtat ctggtgggtttgtttgaagatactaatctgtgtgccatccacgctaagagagtcaccatc atgcccaaagacatccagttggctcgccggatacggggagagagagcttaa

DBGET integrated database retrieval system