Bos indicus (zebu cattle): 109573782 Help Entry 109573782         CDS       T04792                                  Symbol PFN1 Name (RefSeq) profilin-1   KO K05759   profilin Organism biu  Bos indicus (zebu cattle) Pathway biu04015   Rap1 signaling pathway biu04810   Regulation of actin cytoskeleton biu05014   Amyotrophic lateral sclerosis biu05132   Salmonella infection Brite KEGG Orthology (KO) [BR:biu00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     109573782 (PFN1)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     109573782 (PFN1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     109573782 (PFN1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     109573782 (PFN1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:biu04131]     109573782 (PFN1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:biu04812]     109573782 (PFN1)    04147 Exosome [BR:biu04147]     109573782 (PFN1) Membrane trafficking [BR:biu04131]  Others   Actin-binding proteins    Others     109573782 (PFN1) Cytoskeleton proteins [BR:biu04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      109573782 (PFN1) Exosome [BR:biu04147]  Exosomal proteins   Proteins found in most exosomes    109573782 (PFN1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  109573782 NCBI-ProteinID:  XP_019836782 UniProt:  A0A6P5DHW6 LinkDB All DBs Position 19:26821039..26824448 Genome browser AA seq 140 aa AA seqDB search MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGILVGKDRSSFF VNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNITVTMTAKTLVLLMGKEGVH GGMINKKCYEMASHLRRSQY NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccgggtggaacgcctacatcgacaacctcatggcggacgggacctgtcaggacgca gccatcgtgggctataaggactcgccctccgtctgggccgccgtccccggcaagaccttc gtcaacatcacgcctgctgaggtcggtatcctggttggcaaagaccggtcaagttttttc gtgaacgggctaacacttgggggccagaaatgttctgtgatccgggactcactgctgcag gatggagaatttaccatggatcttcgtaccaagagcaccggtggagccccaaccttcaat atcacggtcaccatgactgccaagacgctagtcctgctgatgggcaaagaaggtgtccac ggcggtatgatcaacaagaaatgttatgaaatggcttctcacctgcggcgttcccagtac tga

DBGET integrated database retrieval system