Bos indicus (zebu cattle): 109574464 Help Entry 109574464         CDS       T04792                                  Name (RefSeq) C-C motif chemokine 2   KO K14624   C-C motif chemokine 2 Organism biu  Bos indicus (zebu cattle) Pathway biu04060   Cytokine-cytokine receptor interaction biu04061   Viral protein interaction with cytokine and cytokine receptor biu04062   Chemokine signaling pathway biu04621   NOD-like receptor signaling pathway biu04657   IL-17 signaling pathway biu04668   TNF signaling pathway biu04933   AGE-RAGE signaling pathway in diabetic complications biu05135   Yersinia infection biu05142   Chagas disease biu05144   Malaria biu05163   Human cytomegalovirus infection biu05164   Influenza A biu05168   Herpes simplex virus 1 infection biu05171   Coronavirus disease biu05323   Rheumatoid arthritis biu05417   Lipid and atherosclerosis biu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:biu00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     109574464   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     109574464    04061 Viral protein interaction with cytokine and cytokine receptor     109574464  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     109574464    04657 IL-17 signaling pathway     109574464    04062 Chemokine signaling pathway     109574464  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease     109574464    05164 Influenza A     109574464    05168 Herpes simplex virus 1 infection     109574464    05163 Human cytomegalovirus infection     109574464   09171 Infectious disease: bacterial    05135 Yersinia infection     109574464   09174 Infectious disease: parasitic    05144 Malaria     109574464    05142 Chagas disease     109574464   09163 Immune disease    05323 Rheumatoid arthritis     109574464   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     109574464    05418 Fluid shear stress and atherosclerosis     109574464   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     109574464  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:biu04052]     109574464    00536 Glycosaminoglycan binding proteins [BR:biu00536]     109574464 Cytokines and neuropeptides [BR:biu04052]  Cytokines   Chemokines    109574464 Glycosaminoglycan binding proteins [BR:biu00536]  Heparan sulfate / Heparin   Chemokines    109574464 SSDB OrthologParalogGFIT Motif Pfam:  IL8 GPR15L DUF5480 CXCL16 Motif Other DBs NCBI-GeneID:  109574464 NCBI-ProteinID:  XP_019838059 UniProt:  B5AEI5 LinkDB All DBs Position 19:complement(15665282..15667186) Genome browser AA seq 99 aa AA seqDB search MKVSAALLCLLLTVAAFSTEVLAQPDAINSQVACCYTFNSKKISMQRLMNYRRVTSSKCP KEAVIFKTVLGKELCADPKQKWVQDSINYLNKKNQTPKP NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctccgctgccctcctgtgcctgctactcacagtagctgccttcagcaccgag gtgctcgctcagccagatgcaattaactcccaagtcgcctgctgctatacattcaacagt aagaagatctccatgcagaggctgatgaactacagaagagtcaccagcagcaagtgtcct aaagaggctgtgattttcaagaccgtcctgggcaaggagttatgtgcagaccccaagcag aaatgggtccaggactccataaactatcttaacaagaaaaaccaaactccaaagccttga

DBGET integrated database retrieval system