Bos indicus (zebu cattle): 109574476 Help Entry 109574476         CDS       T04792                                  Name (RefSeq) C-C motif chemokine 3-like   KO K05408   C-C motif chemokine 3 Organism biu  Bos indicus (zebu cattle) Pathway biu04060   Cytokine-cytokine receptor interaction biu04061   Viral protein interaction with cytokine and cytokine receptor biu04062   Chemokine signaling pathway biu04620   Toll-like receptor signaling pathway biu05142   Chagas disease biu05163   Human cytomegalovirus infection biu05323   Rheumatoid arthritis biu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:biu00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     109574476    04061 Viral protein interaction with cytokine and cytokine receptor     109574476  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     109574476    04062 Chemokine signaling pathway     109574476  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     109574476   09174 Infectious disease: parasitic    05142 Chagas disease     109574476   09163 Immune disease    05323 Rheumatoid arthritis     109574476   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     109574476  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:biu04052]     109574476    00536 Glycosaminoglycan binding proteins [BR:biu00536]     109574476 Cytokines and neuropeptides [BR:biu04052]  Cytokines   Chemokines    109574476 Glycosaminoglycan binding proteins [BR:biu00536]  Heparan sulfate / Heparin   Chemokines    109574476 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Cas12f1-like_TNB Motif Other DBs NCBI-GeneID:  109574476 NCBI-ProteinID:  XP_019838074 UniProt:  A0A6P5DJZ5 LinkDB All DBs Position 19:complement(13849938..13851629) Genome browser AA seq 93 aa AA seqDB search MEVPVAALAVLLLTAALSAHTCSASLGANTPTACCFSFVSRQIPRKFVDDYYETSSQCSK PGIIFKTKRGRQVCADPSEDWVQEYITDLELNP NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggaggtccccgtggccgccctggctgtcctgctgctcaccgcggccctctctgcccac acctgctctgccagccttggtgccaacaccccgaccgcctgctgcttctccttcgtctcc cggcagatcccacgcaaattcgtggacgactattatgagaccagcagccagtgctccaag cccggcatcatcttcaagacgaaaagaggccggcaggtctgtgccgaccccagtgaggac tgggtccaggaatacatcaccgacctggagctgaatccctga

DBGET integrated database retrieval system