Bos indicus (zebu cattle): 109575799 Help Entry 109575799         CDS       T04792                                  Symbol GHRL Name (RefSeq) appetite-regulating hormone   KO K05254   ghrelin Organism biu  Bos indicus (zebu cattle) Pathway biu04024   cAMP signaling pathway biu04080   Neuroactive ligand-receptor interaction biu04935   Growth hormone synthesis, secretion and action Brite KEGG Orthology (KO) [BR:biu00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     109575799 (GHRL)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     109575799 (GHRL)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     109575799 (GHRL)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:biu04052]     109575799 (GHRL) Cytokines and neuropeptides [BR:biu04052]  Neuropeptides   Neuropeptides (GPCR binding)    109575799 (GHRL) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Motilin_assoc Motilin_ghrelin Motif Other DBs NCBI-GeneID:  109575799 NCBI-ProteinID:  XP_019839626 UniProt:  A0A6P5DNA0 LinkDB All DBs Position 22:complement(55748627..55753180) Genome browser AA seq 116 aa AA seqDB search MPAPWTICSLLLLSVLCMDLAMAGSSFLSPEHQKLQRKEAKKPSGRLKPRTLEGQFDPEV GSQAEGAEDELEIRFNAPFNIGIKLAGAQSLQHGQTLGKFLQDILWEEAEETLANE NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgcccgccccgtggaccatctgcagcctgctgctgctcagcgtgctctgcatggacttg gccatggcgggctccagctttctgagccccgaacatcagaaactgcagagaaaggaagct aagaagccatcaggcagactgaagccccggaccctggaaggccagtttgacccggaggtg ggaagtcaggcggaaggtgcagaggacgagctggaaatccggttcaacgccccctttaac attgggatcaagctagcaggggctcagtccctccagcatggccagacgttggggaagttt cttcaggacatcctttgggaagaagctgaagaaaccctggctaacgagtga

DBGET integrated database retrieval system