Bos indicus (zebu cattle): 109575954
Help
Entry
109575954 CDS
T04792
Name
(RefSeq) cathelicidin-1-like
KO
K13916
cathelicidin antimicrobial peptide
Organism
biu
Bos indicus (zebu cattle)
Pathway
biu04613
Neutrophil extracellular trap formation
biu04621
NOD-like receptor signaling pathway
biu04970
Salivary secretion
biu05150
Staphylococcus aureus infection
biu05152
Tuberculosis
Brite
KEGG Orthology (KO) [BR:
biu00001
]
09150 Organismal Systems
09151 Immune system
04613 Neutrophil extracellular trap formation
109575954
04621 NOD-like receptor signaling pathway
109575954
09154 Digestive system
04970 Salivary secretion
109575954
09160 Human Diseases
09171 Infectious disease: bacterial
05150 Staphylococcus aureus infection
109575954
05152 Tuberculosis
109575954
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Cathelicidins
Spp-24
Ectatomin
Cystatin
Motif
Other DBs
NCBI-GeneID:
109575954
NCBI-ProteinID:
XP_019839767
LinkDB
All DBs
Position
22:complement(52856225..52858783)
Genome browser
AA seq
155 aa
AA seq
DB search
MQTQRASLSLGRWSLWLLLLGLVVPSASAQALSYREAVLRAVDQLNELSSEANLYRLLEL
DPPPKDNEDLGTRKPVSFTVKETVCPRTIQQPAEQCDFKEKGLLKRCEGTVTLDQVRGNF
DITCNNHRSIRITKQPWAPPQAARLCRIVVIRVCR
NT seq
468 nt
NT seq
+upstream
nt +downstream
nt
atgcagacccagagggccagcctctcactggggcggtggtcactgtggctactgctgctg
ggactagtggtgccctcggccagcgcccaagccctcagctacagggaggccgtgcttcgt
gctgtggatcagctcaatgagctgtcctcagaagctaatctctaccgcctcctggagcta
gacccacctcccaaggataatgaagatctgggcactcgaaagcctgtgagcttcacggtg
aaggagactgtgtgccccaggacgattcagcagcccgcggagcagtgtgacttcaaggag
aaagggctgctgaaacgctgtgaggggacagtcaccctggaccaggtcaggggtaacttc
gacatcacctgtaataatcaccggagcatcaggattacaaagcagccatgggcaccacca
caggcagcccgattatgtcgcattgtagtgataagggtttgcagataa
DBGET
integrated database retrieval system