Bos indicus (zebu cattle): 109576382 Help Entry 109576382         CDS       T04792                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism biu  Bos indicus (zebu cattle) Brite KEGG Orthology (KO) [BR:biu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:biu03041]     109576382   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:biu04052]     109576382 Spliceosome [BR:biu03041]  Complex B   Other components    Complex B specific factors     109576382 Cytokines and neuropeptides [BR:biu04052]  Neuropeptides   Unclassified    109576382 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Crinkler Motif Other DBs NCBI-GeneID:  109576382 NCBI-ProteinID:  XP_019840549 UniProt:  A0A6P5DRQ2 LinkDB All DBs Position 2:complement(24010496..24010942) Genome browser AA seq 73 aa AA seqDB search MIEVVCNDRLGKKVXVKCNXDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHXSLGDY EIHDGMNLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgaggttgtttgcaacgaccgtctggggaagaaggtgcrcgttaagtgcaatayg gatgacaccatcggggaccttaagaagctgatcgcagcccaaactggcacccgttggaac aagatcgtattgaagaagtggtacacgatttttaaggaccatatrtctctgggggactat gaaatccacgatgggatgaacctggagctttattaccaatag

DBGET integrated database retrieval system