Bos indicus (zebu cattle): 109576913 Help Entry 109576913         CDS       T04792                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism biu  Bos indicus (zebu cattle) Pathway biu04613   Neutrophil extracellular trap formation biu05034   Alcoholism biu05203   Viral carcinogenesis biu05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:biu00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     109576913  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     109576913   09163 Immune disease    05322 Systemic lupus erythematosus     109576913   09165 Substance dependence    05034 Alcoholism     109576913  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:biu03036]     109576913 Chromosome and associated proteins [BR:biu03036]  Eukaryotic type   Nucleosome assembly factors    Histones     109576913 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  109576913 NCBI-ProteinID:  XP_019841113 UniProt:  A0A6P5DT92 LinkDB All DBs Position 23:complement(31838569..31838984) Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggacgcggtaaaggcggaaaggggctcggaaaaggtggtgctaagcgccatcgt aaagttctgcgagataatatccagggcatcactaagcccgccattcgtcgcctggcccgc cgtggtggtgttaaacggatttctgggctcatctacgaggagacccgcggggtgctgaag gtgttcctggagaacgtgatccgggacgcggtcacctacaccgagcacgccaagcgcaaa actgtcaccgccatggacgtggtctacgcgctcaagcgccagggacgcactctctacggc ttcggcggttaa

DBGET integrated database retrieval system