Bos indicus (zebu cattle): 109577169 Help Entry 109577169         CDS       T04792                                  Symbol CSNK2B Name (RefSeq) casein kinase II subunit beta   KO K03115   casein kinase II subunit beta Organism biu  Bos indicus (zebu cattle) Pathway biu03008   Ribosome biogenesis in eukaryotes biu03083   Polycomb repressive complex biu04064   NF-kappa B signaling pathway biu04137   Mitophagy - animal biu04310   Wnt signaling pathway biu04520   Adherens junction biu05010   Alzheimer disease biu05020   Prion disease biu05022   Pathways of neurodegeneration - multiple diseases biu05162   Measles biu05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:biu00001]  09120 Genetic Information Processing   09122 Translation    03008 Ribosome biogenesis in eukaryotes     109577169 (CSNK2B)   09126 Chromosome    03083 Polycomb repressive complex     109577169 (CSNK2B)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     109577169 (CSNK2B)    04064 NF-kappa B signaling pathway     109577169 (CSNK2B)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     109577169 (CSNK2B)   09144 Cellular community - eukaryotes    04520 Adherens junction     109577169 (CSNK2B)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     109577169 (CSNK2B)   09172 Infectious disease: viral    05162 Measles     109577169 (CSNK2B)   09164 Neurodegenerative disease    05010 Alzheimer disease     109577169 (CSNK2B)    05020 Prion disease     109577169 (CSNK2B)    05022 Pathways of neurodegeneration - multiple diseases     109577169 (CSNK2B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03009 Ribosome biogenesis [BR:biu03009]     109577169 (CSNK2B)    03036 Chromosome and associated proteins [BR:biu03036]     109577169 (CSNK2B) Ribosome biogenesis [BR:biu03009]  Eukaryotic type   90S particles    Kinase     109577169 (CSNK2B) Chromosome and associated proteins [BR:biu03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.3/1.5)      109577169 (CSNK2B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CK_II_beta Motif Other DBs NCBI-GeneID:  109577169 NCBI-ProteinID:  XP_019841515 UniProt:  A0A6P5DWT1 LinkDB All DBs Position 23:complement(27387092..27392459) Genome browser AA seq 215 aa AA seqDB search MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDE ELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPML PIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPA NQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgagcagctcagaggaggtgtcctggatttcctggttctgtgggctccgtggcaatgaa ttcttctgtgaggtggatgaagactatatccaggacaaattcaatctcactggactcaat gagcaggtgcctcactatcgacaagctttagacatgatcttggacctggagcctgatgag gagctggaggacaaccccaaccagagtgacctgattgagcaagcagctgaaatgctctat ggattgatccacgcccgctatatcctcaccaaccgtggcattgcccagatgttggaaaag taccagcagggagactttggatactgtccccgtgtgtactgtgagaaccagccaatgctt cccatcggcctttcagacatcccaggtgaggccatggtgaagctctactgccccaagtgc atggacgtgtacacacccaagtcatcgaggcaccaccacacggatggcgcctacttcggc accggtttccctcacatgctcttcatggtgcaccccgagtaccggcccaagaggcccgcc aaccagtttgtgcccaggctttacggtttcaagatccatccaatggcctaccagctgcag ctccaagccgccagcaacttcaagagcccagtgaagacgattcgctga

DBGET integrated database retrieval system