Bos indicus (zebu cattle): 109578171 Help Entry 109578171         CDS       T04792                                  Symbol MYL10 Name (RefSeq) myosin regulatory light chain 10   KO K12756   myosin regulatory light chain 10 Organism biu  Bos indicus (zebu cattle) Pathway biu04510   Focal adhesion biu04520   Adherens junction biu04670   Leukocyte transendothelial migration biu04810   Regulation of actin cytoskeleton biu04814   Motor proteins biu05132   Salmonella infection Brite KEGG Orthology (KO) [BR:biu00001]  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     109578171 (MYL10)    04520 Adherens junction     109578171 (MYL10)   09142 Cell motility    04814 Motor proteins     109578171 (MYL10)    04810 Regulation of actin cytoskeleton     109578171 (MYL10)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     109578171 (MYL10)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     109578171 (MYL10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:biu04812]     109578171 (MYL10) Cytoskeleton proteins [BR:biu04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      109578171 (MYL10) SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_6 CFAP251_C Motif Other DBs NCBI-GeneID:  109578171 NCBI-ProteinID:  XP_019842728 LinkDB All DBs Position 25 Genome browser AA seq 143 aa AA seqDB search MAPRRARKKAEGGASSNVFSMFDQSQIQEFKEVGRINVKNEELEAMVKEAPGPINFTVFL TMFGEKLKGTDPEETILHAFKVFDTEGKGFVKADFIKEKLMTQADRFSEEEVKQMFAAFP PDVCGNLDYRNLCYVITHGEEKD NT seq 432 nt NT seq  +upstreamnt  +downstreamnt atggcacccagaagagcccggaaaaaagcagaaggaggagccagctccaacgtcttctcc atgtttgatcagtcccagatccaggagtttaaagaggtcggccgcatcaatgtaaagaac gaggagctggaggccatggtgaaggaggcccctgggcccatcaacttcactgtcttcctg accatgtttggggagaagctgaagggtacagacccagaggagaccatcctccacgccttc aaggtgttcgacactgaagggaaaggtttcgtcaaggctgatttcatcaaagagaagctc atgacgcaggcagaccggttcagtgaggaggaggtcaagcagatgtttgccgctttcccg ccagatgtgtgtggcaatctggactacaggaacctgtgttacgtcatcacgcatggtgaa gagaaggactag

DBGET integrated database retrieval system