Bos indicus (zebu cattle): 109579084 Help Entry 109579084         CDS       T04792                                  Symbol FGF8 Name (RefSeq) fibroblast growth factor 8   KO K04358   fibroblast growth factor Organism biu  Bos indicus (zebu cattle) Pathway biu04010   MAPK signaling pathway biu04014   Ras signaling pathway biu04015   Rap1 signaling pathway biu04020   Calcium signaling pathway biu04151   PI3K-Akt signaling pathway biu04810   Regulation of actin cytoskeleton biu05200   Pathways in cancer biu05207   Chemical carcinogenesis - receptor activation biu05218   Melanoma biu05224   Breast cancer biu05226   Gastric cancer Brite KEGG Orthology (KO) [BR:biu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     109579084 (FGF8)    04014 Ras signaling pathway     109579084 (FGF8)    04015 Rap1 signaling pathway     109579084 (FGF8)    04020 Calcium signaling pathway     109579084 (FGF8)    04151 PI3K-Akt signaling pathway     109579084 (FGF8)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     109579084 (FGF8)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109579084 (FGF8)    05207 Chemical carcinogenesis - receptor activation     109579084 (FGF8)   09162 Cancer: specific types    05226 Gastric cancer     109579084 (FGF8)    05218 Melanoma     109579084 (FGF8)    05224 Breast cancer     109579084 (FGF8)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:biu04052]     109579084 (FGF8)    00536 Glycosaminoglycan binding proteins [BR:biu00536]     109579084 (FGF8) Cytokines and neuropeptides [BR:biu04052]  Cytokines   Growth factors (RTK binding)    109579084 (FGF8) Glycosaminoglycan binding proteins [BR:biu00536]  Heparan sulfate / Heparin   Growth factors/receptors    109579084 (FGF8) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FGF FRG1 Motif Other DBs NCBI-GeneID:  109579084 NCBI-ProteinID:  XP_019844146 UniProt:  A0A6P5E4A3 LinkDB All DBs Position 26:complement(22918736..22923865) Genome browser AA seq 140 aa AA seqDB search MAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLE NNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLN YPPFTRSLRGSQRTWAPEPR NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggcagaagacggggaccccttcgcaaagctcatcgtggagacagacaccttcgggagc cgggttcgagtacgaggagctgagacaggcctctacatctgcatgaacaagaagggaaaa ttgattgccaagagcaacggcaaaggcaaggactgcgtgttcacggagatcgtgctggag aacaattacacggccctgcagaacgccaagtacgagggctggtacatggctttcacgcgc aaaggccgaccccgcaagggctccaagacccggcagcaccagcgcgaagtccacttcatg aagcggctgccccgcggccaccacaccaccgagcagagcctgcgcttcgagttcctcaac tacccgcccttcacgcgcagcctgcgcggcagccagaggacttgggcccctgagccccga tag

DBGET integrated database retrieval system