Bos indicus (zebu cattle): 2885969 Help Entry 2885969           CDS       T04792                                  Symbol ND4L Name (RefSeq) NADH dehydrogenase subunit 4L   KO K03882   NADH-ubiquinone oxidoreductase chain 4L [EC:7.1.1.2] Organism biu  Bos indicus (zebu cattle) Pathway biu00190   Oxidative phosphorylation biu01100   Metabolic pathways biu04714   Thermogenesis biu04723   Retrograde endocannabinoid signaling biu05010   Alzheimer disease biu05012   Parkinson disease biu05014   Amyotrophic lateral sclerosis biu05016   Huntington disease biu05020   Prion disease biu05022   Pathways of neurodegeneration - multiple diseases biu05208   Chemical carcinogenesis - reactive oxygen species biu05415   Diabetic cardiomyopathy Module biu_M00142   NADH:ubiquinone oxidoreductase, mitochondria Brite KEGG Orthology (KO) [BR:biu00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     2885969 (ND4L)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     2885969 (ND4L)   09159 Environmental adaptation    04714 Thermogenesis     2885969 (ND4L)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     2885969 (ND4L)   09164 Neurodegenerative disease    05010 Alzheimer disease     2885969 (ND4L)    05012 Parkinson disease     2885969 (ND4L)    05014 Amyotrophic lateral sclerosis     2885969 (ND4L)    05016 Huntington disease     2885969 (ND4L)    05020 Prion disease     2885969 (ND4L)    05022 Pathways of neurodegeneration - multiple diseases     2885969 (ND4L)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     2885969 (ND4L)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:biu03029]     2885969 (ND4L) Enzymes [BR:biu01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      2885969 (ND4L) Mitochondrial biogenesis [BR:biu03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     2885969 (ND4L) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Oxidored_q2 Motif Other DBs NCBI-GeneID:  2885969 NCBI-ProteinID:  YP_052705 UniProt:  Q6EMS3 E7BTI7 LinkDB All DBs Position MT:10242..10538 Genome browser AA seq 98 aa AA seqDB search MSMVYMNIMMAFTVSLVGLLMYRSHLMSSLLCLEGMMLSLFVMAALTILNSHFTLASMMP IILLVFAACEAALGLSLLVMVSNTYGTDYVQNLNLLQC NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgtctatagtatacataaacattataatggcattcacagtatctcttgtaggactacta atataccgatcccacctaatatcttcccttctgtgcttagaaggaataatgctatcccta ttcgttatagcagccctaacaatcctcaactcacattttacattagctagcataatacct attatcctactagtcttcgcagcctgcgaagcagccctaggtctatctctactagtaata gtatcaaatacatatggtactgattatgtacaaaacctcaacttactccaatgctaa

DBGET integrated database retrieval system