Bradyrhizobium japonicum E109: RN69_25580 Help Entry RN69_25580        CDS       T03509                                  Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism bjp  Bradyrhizobium japonicum E109 Pathway bjp02024   Quorum sensing bjp03018   RNA degradation Brite KEGG Orthology (KO) [BR:bjp00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     RN69_25580  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     RN69_25580  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:bjp03019]     RN69_25580    03036 Chromosome and associated proteins [BR:bjp03036]     RN69_25580 Messenger RNA biogenesis [BR:bjp03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      RN69_25580 Chromosome and associated proteins [BR:bjp03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     RN69_25580 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 Motif Other DBs NCBI-ProteinID:  AJA63323 UniProt:  A0A0A3XRY1 LinkDB All DBs Position complement(5382407..5382655) Genome browser AA seq 82 aa AA seqDB search MAADRAQNLQDTFLNHVRKTKTPLTIFLVNGVKLQGIVTWFDNFCLLLRRDGHSQLVYKH AISTIMPGAPIQLFEGGEDQPA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggcggcagaccgcgcacaaaacctacaggacaccttcctcaatcacgttcgcaaaacc aagacgccactgacgatctttctggtcaacggagtgaagctccagggcatcgtgacctgg ttcgacaatttctgtttgctgcttcggcgcgacggtcactcgcagcttgtctacaagcat gcgatctcgaccatcatgccgggcgctccgatccagttgttcgaaggcggcgaggatcag ccggcttga

DBGET integrated database retrieval system