Bacillus sp. JS: MY9_2930 Help Entry MY9_2930          CDS       T02027                                  Name (GenBank) redoxin   KO K03676   glutaredoxin 3 Organism bjs  Bacillus sp. JS Brite KEGG Orthology (KO) [BR:bjs00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:bjs03110]     MY9_2930 Chaperones and folding catalysts [BR:bjs03110]  Protein folding catalysts   Protein disulfide isomerase    MY9_2930 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 Glrx-like GST_N_2 Thioredoxin_3 Thioredoxin_2 zf-C2H2_10 SH3BGR Peptidase_S51 Motif Other DBs NCBI-ProteinID:  AFI29463 LinkDB All DBs Position complement(2867399..2867665) Genome browser AA seq 88 aa AA seqDB search MSDVVNIVVWSKKGCSYCEEVKNYLNEKGFPFQHIDVSEKEKLRDILQVKYGVRHVPVVE IGRGNQYQGITEIGIEHLDLALANYIQR NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgagtgatgttgtgaacattgtggtttggagtaaaaaaggctgttcgtattgtgaggaa gtcaagaattatttgaatgaaaaagggttcccgttccaacatatcgatgtttcagagaaa gaaaagcttcgagatattttacaggtgaaatatggggtgcgccatgtgcctgtggtcgaa atcgggcgcggcaatcagtatcaagggataactgagatcggcattgaacaccttgatctg gcacttgcgaattatatccaaagataa

DBGET integrated database retrieval system