Bacillus sp. JS: MY9_3773 Help Entry MY9_3773          CDS       T02027                                  Name (GenBank) ribose-5-phosphate isomerase B   KO K01808   ribose 5-phosphate isomerase B [EC:5.3.1.6] Organism bjs  Bacillus sp. JS Pathway bjs00030   Pentose phosphate pathway bjs00051   Fructose and mannose metabolism bjs00710   Carbon fixation by Calvin cycle bjs01100   Metabolic pathways bjs01110   Biosynthesis of secondary metabolites bjs01120   Microbial metabolism in diverse environments bjs01200   Carbon metabolism bjs01230   Biosynthesis of amino acids Module bjs_M00004   Pentose phosphate pathway (Pentose phosphate cycle) bjs_M00007   Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P Brite KEGG Orthology (KO) [BR:bjs00001]  09100 Metabolism   09101 Carbohydrate metabolism    00030 Pentose phosphate pathway     MY9_3773    00051 Fructose and mannose metabolism     MY9_3773   09102 Energy metabolism    00710 Carbon fixation by Calvin cycle     MY9_3773 Enzymes [BR:bjs01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.1  Interconverting aldoses and ketoses, and related compounds     5.3.1.6  ribose-5-phosphate isomerase      MY9_3773 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LacAB_rpiB Motif Other DBs NCBI-ProteinID:  AFI30305 LinkDB All DBs Position complement(3688344..3688793) Genome browser AA seq 149 aa AA seqDB search MKVAIASDHGGVHIRNEIKDLMDELQIEYIDMGCDCGSGSVDYPDYAFPVAEKVVSGEVD RGILICGTGIGMSISANKVKGIRCALAHDTFSAKATREHNDTNILAMGERVIGPGLAREI AKIWLTTEFTGGRHQTRIGKISDYEEKNL NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atgaaagtagccattgcatcggatcatggcggcgttcacattcgaaatgaaatcaaagat ttaatggacgaattgcaaattgaatatattgatatgggctgcgactgcggcagcggctct gtcgattatccggattatgcttttccggtggccgaaaaagtggttagcggcgaagttgac agaggaattttaatttgcgggacaggcatcggcatgagcatttccgcaaataaagtaaaa gggattcgctgcgcgctggcgcacgataccttcagcgccaaggcgacgagggagcataat gacacaaacatccttgcgatgggtgaacgggtgatcggccctggtttggctcgggaaatc gcaaaaatctggctgaccactgagtttaccggaggaagacaccaaacgcgtattggaaaa atctcagattatgaagagaaaaacctgtag

DBGET integrated database retrieval system