Bradyrhizobium japonicum USDA 6: BJ6T_02210 Help Entry BJ6T_02210        CDS       T01848                                  Name (GenBank) glutaredoxin   KO K03676   glutaredoxin 3 Organism bju  Bradyrhizobium japonicum USDA 6 Brite KEGG Orthology (KO) [BR:bju00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:bju03110]     BJ6T_02210 Chaperones and folding catalysts [BR:bju03110]  Protein folding catalysts   Protein disulfide isomerase    BJ6T_02210 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Glrx-like SH3BGR DUF1223 Motif Other DBs NCBI-ProteinID:  BAL05521 LinkDB All DBs Position 214482..214757 Genome browser AA seq 91 aa AA seqDB search MTDAVEIYTRPGCGYCSAAKSLLTRKKATFTEFDIAKNPSWREEMYDRAGGGSTFPQIWI GGTHVGGCDELYALDREGKLDGMLGSVKATS NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaccgacgctgtcgaaatctacaccaggccgggctgtggctattgttccgccgccaaa tcgctgctgacccgcaagaaggcaaccttcacggagttcgacatcgccaagaacccgtcc tggcgcgaggagatgtacgaccgcgccggcgggggctcgactttcccgcagatctggatc ggcggaacccacgtcggcggttgcgacgagctctatgcgctcgaccgcgagggcaagctc gacggcatgctgggcagcgtgaaggccacgtcatga

DBGET integrated database retrieval system