Bos javanicus (banteng): 133233461 Help Entry 133233461         CDS       T11659                                  Name (RefSeq) calmodulin-alpha-like   KO K02183   calmodulin Organism bjv  Bos javanicus (banteng) Pathway bjv04014   Ras signaling pathway bjv04015   Rap1 signaling pathway bjv04020   Calcium signaling pathway bjv04022   cGMP-PKG signaling pathway bjv04024   cAMP signaling pathway bjv04070   Phosphatidylinositol signaling system bjv04114   Oocyte meiosis bjv04218   Cellular senescence bjv04261   Adrenergic signaling in cardiomyocytes bjv04270   Vascular smooth muscle contraction bjv04371   Apelin signaling pathway bjv04625   C-type lectin receptor signaling pathway bjv04713   Circadian entrainment bjv04720   Long-term potentiation bjv04722   Neurotrophin signaling pathway bjv04728   Dopaminergic synapse bjv04740   Olfactory transduction bjv04744   Phototransduction bjv04750   Inflammatory mediator regulation of TRP channels bjv04910   Insulin signaling pathway bjv04912   GnRH signaling pathway bjv04915   Estrogen signaling pathway bjv04916   Melanogenesis bjv04921   Oxytocin signaling pathway bjv04922   Glucagon signaling pathway bjv04924   Renin secretion bjv04925   Aldosterone synthesis and secretion bjv04970   Salivary secretion bjv04971   Gastric acid secretion bjv05010   Alzheimer disease bjv05012   Parkinson disease bjv05022   Pathways of neurodegeneration - multiple diseases bjv05031   Amphetamine addiction bjv05034   Alcoholism bjv05133   Pertussis bjv05152   Tuberculosis bjv05163   Human cytomegalovirus infection bjv05167   Kaposi sarcoma-associated herpesvirus infection bjv05170   Human immunodeficiency virus 1 infection bjv05200   Pathways in cancer bjv05214   Glioma bjv05417   Lipid and atherosclerosis bjv05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:bjv00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     133233461    04015 Rap1 signaling pathway     133233461    04371 Apelin signaling pathway     133233461    04020 Calcium signaling pathway     133233461    04070 Phosphatidylinositol signaling system     133233461    04024 cAMP signaling pathway     133233461    04022 cGMP-PKG signaling pathway     133233461  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     133233461    04218 Cellular senescence     133233461  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     133233461   09152 Endocrine system    04910 Insulin signaling pathway     133233461    04922 Glucagon signaling pathway     133233461    04912 GnRH signaling pathway     133233461    04915 Estrogen signaling pathway     133233461    04921 Oxytocin signaling pathway     133233461    04916 Melanogenesis     133233461    04924 Renin secretion     133233461    04925 Aldosterone synthesis and secretion     133233461   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     133233461    04270 Vascular smooth muscle contraction     133233461   09154 Digestive system    04970 Salivary secretion     133233461    04971 Gastric acid secretion     133233461   09156 Nervous system    04728 Dopaminergic synapse     133233461    04720 Long-term potentiation     133233461    04722 Neurotrophin signaling pathway     133233461   09157 Sensory system    04744 Phototransduction     133233461    04740 Olfactory transduction     133233461    04750 Inflammatory mediator regulation of TRP channels     133233461   09159 Environmental adaptation    04713 Circadian entrainment     133233461  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     133233461   09162 Cancer: specific types    05214 Glioma     133233461   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     133233461    05163 Human cytomegalovirus infection     133233461    05167 Kaposi sarcoma-associated herpesvirus infection     133233461   09171 Infectious disease: bacterial    05133 Pertussis     133233461    05152 Tuberculosis     133233461   09164 Neurodegenerative disease    05010 Alzheimer disease     133233461    05012 Parkinson disease     133233461    05022 Pathways of neurodegeneration - multiple diseases     133233461   09165 Substance dependence    05031 Amphetamine addiction     133233461    05034 Alcoholism     133233461   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     133233461    05418 Fluid shear stress and atherosclerosis     133233461  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:bjv01009]     133233461   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bjv04131]     133233461    03036 Chromosome and associated proteins [BR:bjv03036]     133233461   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bjv04147]     133233461 Protein phosphatases and associated proteins [BR:bjv01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      133233461 Membrane trafficking [BR:bjv04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     133233461 Chromosome and associated proteins [BR:bjv03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      133233461 Exosome [BR:bjv04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    133233461 SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 CFAP251_C EF-hand_FSTL1 EH Allatotropin-like_C EF_EFCAB10_C SPARC_Ca_bdg EF-hand_11 UPF0154 SAPC2_N EFhand_Ca_insen EF-hand_EFHB_C Dockerin_1 Caleosin BamM_C DUF1103 TerB DUF5580_M FCaBP_EF-hand SPEF2_C EF-hand_STIM1 SurA_N_3 PA_Ig-like Motif Other DBs NCBI-GeneID:  133233461 NCBI-ProteinID:  XP_061249269 LinkDB All DBs Position 20:8027546..8028690 Genome browser AA seq 149 aa AA seqDB search MADQLTEEQIAEFQEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDE EVDEMIREADIDGDGQVNYEEFVHMMTAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggctgaccaactgactgaagagcagattgcagaattccaagaagctttttcactattt gacaaggatggtgatggaactataacaacaaaggaattgggaactgtaatgaggtctctt gggcagaatcccacagaagcagagttacaggacatgattaatgaagtagatgctgatggt aatggcacaattgacttcccggaatttctgacaatgatggcaagaaaaatgaaagataca gacagtgaagaagaaattagagaagcatttcgtgtgtttgataaggatggtaatggctat attagtgcagcagagctccgccatgtgatgacaaaccttggagagaagttaacagatgaa gaggttgatgaaatgatcagggaagcagatattgatggtgatggtcaagtaaactatgaa gagtttgtacatatgatgacagcaaagtga

DBGET integrated database retrieval system