Bos javanicus (banteng): 133240106 Help Entry 133240106         CDS       T11659                                  Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism bjv  Bos javanicus (banteng) Pathway bjv04145   Phagocytosis bjv04814   Motor proteins bjv05132   Salmonella infection Brite KEGG Orthology (KO) [BR:bjv00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     133240106   09142 Cell motility    04814 Motor proteins     133240106  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     133240106  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:bjv03037]     133240106    04812 Cytoskeleton proteins [BR:bjv04812]     133240106 Cilium and associated proteins [BR:bjv03037]  Motile cilia and associated proteins   Dynein arm    133240106 Cytoskeleton proteins [BR:bjv04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      133240106 SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  133240106 NCBI-ProteinID:  XP_061260714 LinkDB All DBs Position 27:complement(43745222..43745968) Genome browser AA seq 113 aa AA seqDB search MEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKP FKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRWENKTMYCIVSAFGLSI NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggaagactaccaggccgccgaggagactgcttttgttgttgatgaagtgagcaacatc gtaaaagaggccatagaaagcgccattggtggcaatgcctatcagcacagcaaagtcaat cagtggaccacaaacgtagtggagcagaccttaagccaactcaccaagctggggaagcca tttaagtacatcgtgacctgtgtgatcatgcagaagaatggagcgggcctgcacacggca agctcgtgcttctgggacagctccaccgatgggagctgcaccgtgcgatgggagaacaag accatgtactgcatcgtcagcgccttcggcctgtccatctga

DBGET integrated database retrieval system